(data stored in ACNUC30630 zone)

EMBL: AE000513.PE75

AE000513.PE75        Location/Qualifiers
FT   CDS_pept        77159..78364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0076"
FT                   /product="molybdopterin biosynthesis MoeA"
FT                   /note="similar to GB:M21151 SP:P12281 PID:145539 GB:U00096
FT                   PID:1651376 percent identity: 60.05; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09669"
FT                   /db_xref="GOA:Q9RY74"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY74"
FT                   /protein_id="AAF09669.1"
FT                   /translation="MTAPTFPMHVSVAQARELFAALLPAPPVVTLPLRKALGCTLGADL
FT                   TALVSHPSATESALDGIACREADTLTASAGAPVALRVVGESRAGEPFAGEVGPGECVRI
FT                   YTGAPLPPGTDAICPVEQLREGEGTSAVERGTVELLRPARPGDVRPEGGDFHAGETVMS
FT                   AGLRLTPARLALAAALGHAQVPVRRWRVALLSTGDEVVAPGQPLAPGQVYDSNRVGLAA
FT                   LLTEAGYEVLDLGHAPDSPAALRERLGAAGGADLLLTSGGVSMGRYDFMRDLLLGEGEI
FT                   TFWKVKMRPGGPALCGRWGGLPVFGLPGNPVSSLVVFQVIVRPVLTGEPLPTRQVTAAT
FT                   PFASLADKTAFWRGVLSGDEVRDYPRQGSGVLRSLSDADALVVVPEGQNIAAGERVEVV
FT                   LL"
     atgaccgccc ccacctttcc catgcacgtg tctgttgcgc aggcgcggga gctgttcgcc        60
     gcgctgctgc ccgcgccgcc cgtcgtgacg ctgcctttgc ggaaggccct cggctgcacg       120
     ctcggcgctg acctcacggc gctcgtcagt catccctcgg ccaccgagag tgccctggac       180
     ggcatcgcct gccgggaggc cgacacgctg accgcctcag cgggggcgcc ggtggccctg       240
     cgcgtggtag gcgaaagccg ggcaggtgag ccgttcgcgg gcgaggtggg gccgggtgag       300
     tgcgtccgca tctacacggg cgctccgctc ccgcccggca ccgacgcgat ttgcccggtg       360
     gagcagttgc gtgaaggaga aggcacaagc gcagtggaga ggggcacagt agagctgctg       420
     cgccccgccc gccccggcga cgtgcgaccc gaggggggcg acttccatgc gggcgagacc       480
     gtcatgtccg ccggactccg cctgaccccg gcgcggctgg cgctggcggc ggcgctcggg       540
     cacgcgcagg tgccggtgcg gcgctggcgg gtggcactgc tctccaccgg cgacgaggtg       600
     gtcgcgccgg ggcagccgct ggcgccgggg caggtttatg attccaaccg cgtgggcctc       660
     gccgcgctgc tcaccgaggc gggctacgag gtgctcgacc tcgggcacgc gcccgactcg       720
     cccgccgccc tgcgggaacg cctgggcgcg gcgggcggcg ccgacttgct gctcaccagc       780
     ggcggcgtca gcatgggccg ctacgacttc atgcgcgacc tgctgctcgg cgagggcgag       840
     atcaccttct ggaaggtgaa gatgcggccc ggtggccccg cgctctgcgg gcgctggggg       900
     gggctgccgg tgttcggtct gccgggcaat ccggtgagca gcctggtcgt gtttcaggtc       960
     atcgtgcgcc cggtgctgac cggcgaaccg ctcccgaccc ggcaggtgac ggcggccact      1020
     ccttttgcct cactggctga caagacggcg ttctggcgcg gcgtgctctc gggcgacgag      1080
     gtgcgcgact acccccgcca gggcagcggc gtcctgcgct cgctgagtga cgccgacgcc      1140
     ctggtcgtcg tgcccgaggg gcagaacatc gcggcgggcg agcgggtgga ggtggtgctg      1200
     ctgtag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page