(data stored in ACNUC30630 zone)

EMBL: AE000513.PE79

AE000513.PE79        Location/Qualifiers
FT   CDS_pept        complement(80645..81706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0080"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="similar to PID:1781357 percent identity: 68.71;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09673"
FT                   /db_xref="GOA:Q9RY70"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY70"
FT                   /protein_id="AAF09673.1"
FT                   /translation="MTTLDRGGVYFFPMTKAARSSKKSAPSVPTPAQARLHTPDTLPRP
FT                   VLAGRDFLSNLDMTSAELRAVMDTAHSMKAGEWRAVKPLSGLSLALVFEKASLRTRTTF
FT                   DVGMYQLGGHAITLSNTEIGLGTRERVSDVARNLERWVDGVMGRVYLQQTLVELAQHAR
FT                   IPVINGLSDMLHPAQLLADYQTIEEEFGQDLRGKRVVYIGDGNNLANSHIHMGILTGTD
FT                   VTVVTPVGYEPNAGVLMDAVKAGVEVHLTNDLDAIQGADVLYTDVWISMGQEAEADIRR
FT                   RAFRGYQVTPEMLETISPDGIFLHCLPAHYGEETVPEATEHPKSRVFDQAENRLHAQKA
FT                   LLYHVLGDMKPRW"
     atgaccactt tggacagggg cggcgtatac tttttcccta tgacgaaggc cgcccgttcc        60
     agtaagaagt ctgctccgtc cgtgcccacc cccgcgcagg cccggcttca cacgccggac       120
     accctgccgc gcccggtgct ggcgggccgc gactttctga gcaacctcga catgacgtcc       180
     gccgagttgc gggcagtcat ggacaccgcg cactccatga aggcgggcga gtggcgcgcg       240
     gtcaagccgc tctcggggct gtcgttggcg ctggtcttcg agaaggcctc cttacgcacc       300
     cgcaccacct tcgatgtggg gatgtaccag ctcggcgggc acgccattac cctttccaac       360
     accgaaatcg gcctgggcac ccgcgagcgc gtgagcgacg tggcgcgcaa cctggagcgc       420
     tgggtggacg gcgtgatggg ccgcgtgtac ctgcaacaga ccctggtgga actcgcgcag       480
     catgcccgca ttccggtcat caacggcctg agcgacatgc tgcacccggc gcaactgctc       540
     gccgactatc agaccatcga ggaagagttc gggcaggacc tgcgcggcaa gcgggtggtg       600
     tacatcggcg acggcaacaa cctcgccaac agccacattc acatgggcat cctgaccggc       660
     accgacgtga cggtggtgac cccggtaggc tacgaaccca acgcgggcgt gctgatggac       720
     gcggtgaagg cgggcgtgga ggtgcacctg accaacgacc tggacgccat tcagggtgcc       780
     gacgtgctgt acaccgacgt gtggatttcg atgggccagg aggccgaagc cgacatccgc       840
     cgccgggctt ttaggggcta tcaggtcacg ccggagatgc tggagaccat ctcgcccgac       900
     ggtatttttc tgcattgtct gcccgcgcac tacggtgaag aaaccgtgcc ggaagccacc       960
     gagcacccca agagccgcgt cttcgaccag gccgagaacc gcctgcacgc gcaaaaggcg      1020
     ctgctctacc acgtgctggg cgacatgaag ccgcgctggt aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page