(data stored in ACNUC30630 zone)

EMBL: AE000513.PE8

AE000513.PE8         Location/Qualifiers
FT   CDS_pept        7819..8859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09603"
FT                   /db_xref="GOA:Q9RYE1"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYE1"
FT                   /protein_id="AAF09603.1"
FT                   /translation="MSGGEAQGKRKQWQRWLSPRYVWRRLRHNIGPKLVSLGAALVLWS
FT                   VSTGDQRAQVQQSYDVPITVRDTTGASGSDERRAVSDLNPETVRVTLTGRPERLNELRP
FT                   SNIEALLDVTGVPEGSFNRPVQIVAPSNTVLSKQVPERVQGFVDSELSRTLTVTLGVAS
FT                   PAENSLPRFEVRPSEVQATAPSRVLNQVTRVVTSPVDLDPGEEREAPLIALDSRGRVVE
FT                   PVTLHPASVSVQRLDTGTLPVKTLPVVLGAPPASLRVQSQTLQPRTVRVVAAPELLGRL
FT                   REVSGQVDYRVGSSTLPVTLRLPDGAQALETVSVSLVVERIKAPDPGAGAPTQQKSGAS
FT                   SSSGGN"
     atgagcggcg gcgaagcgca gggcaagcgc aaacagtggc agcgctggct gagcccgcgg        60
     tacgtatggc ggcggctgcg gcacaacatc ggtcccaaac tggtgtcgct gggggccgcg       120
     ctggtgctgt ggtcggtcag cacgggcgat cagcgggcgc aggtgcagca gagctacgac       180
     gtgccgatta ccgtgcgcga caccaccggg gcgtcgggca gcgacgagcg gcgcgccgtc       240
     agcgacctca accccgagac ggtgcgggtc acgctgaccg ggcgccccga gcgcctgaac       300
     gaactgcgcc ccagcaatat cgaggcgctg ctcgacgtga ccggcgtgcc cgagggcagt       360
     ttcaaccgcc cggtgcagat cgtcgcgccg agcaacacgg tgctcagcaa gcaggtgccc       420
     gagcgggtgc agggcttcgt ggacagcgaa ctcagccgca cgctgaccgt caccctgggg       480
     gtcgcgtcgc ccgccgaaaa cagcctgccg cgctttgagg tccgccccag cgaggtgcag       540
     gccaccgccc cgagccgggt gctcaatcag gtgacgcggg tggtgaccag cccggtcgac       600
     ctcgaccccg gtgaggaacg cgaggccccc ctgattgccc tcgacagccg gggccgggtg       660
     gtcgagccgg tcacgctgca ccccgccagc gtgtcggtgc agcgcctcga taccgggacg       720
     ctgccggtca agacgttacc ggtggtgctg ggggcgcccc cggcgagcct gcgcgttcag       780
     tcccagaccc tgcaaccgcg cacggtgcgg gtggtcgccg cccccgaact gctggggcgc       840
     ctgcgcgagg tcagcggtca ggtggactac cgggtgggca gctccaccct gcccgtcacg       900
     ctgcggctgc ccgacggggc acaggcgctc gagaccgtca gcgtcagcct tgtcgtcgag       960
     cggatcaagg cccccgaccc cggcgcggga gcgcccaccc agcaaaagtc gggggcgtcg      1020
     tcgagcagtg gtgggaattg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page