(data stored in ACNUC30630 zone)

EMBL: AE000513.PE89

AE000513.PE89        Location/Qualifiers
FT   CDS_pept        complement(91257..91955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:577591 percent identity: 54.49;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09683"
FT                   /db_xref="GOA:Q9RY60"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY60"
FT                   /protein_id="AAF09683.1"
FT                   /translation="MPVEGDWTGPLVRLSIRRSLRAELAGVYVTGPLPPGGAVLAPNHQ
FT                   SWWDGYLLGELAWQCGADLRVMMTERQLGRFPFLRRVGAIGTGEVRAAVRHARRGGWTV
FT                   LFPEGALQPPGPLGALHPGAAWVARQAGVPLIPVGLRVLVRGAQKPEAFVRFAPPMPPA
FT                   DLAGALRAAVARLDADLHAADPDLPPAGYLRWVRGASSVHDRPGLPTRLLARLTTLQGA
FT                   SLPAPKGPLR"
     gtgccagttg agggcgactg gaccggcccc ctggtgcgcc tgagcattcg ccgcagcctg        60
     cgcgccgagc tcgccggggt ctacgtgacc gggcctttgc cgcccggcgg cgcggtgctc       120
     gcccccaacc accagtcgtg gtgggacggc tacctgctcg gcgaactcgc ctggcagtgc       180
     ggcgcggacc tccgggtgat gatgaccgag cggcaactcg ggcgctttcc ctttctgcgg       240
     cgggtggggg ccatcggcac cggggaggtc cgcgccgccg tgcgccacgc ccggcgcggc       300
     ggctggacgg ttctctttcc cgagggcgcc ctgcaaccgc ccggcccgct cggcgcgctg       360
     caccccggcg cggcgtgggt ggcccggcaa gcaggcgtgc ccctgattcc cgtcgggctg       420
     cgggtgctgg tgcggggagc gcagaagccc gaagccttcg tgcggttcgc gccgccgatg       480
     ccgcccgccg acctggccgg agccctccgt gctgccgtcg cccggctgga cgccgacctg       540
     cacgccgccg accctgattt gccgcccgcc ggatacctgc gctgggtgcg cggcgcgagc       600
     agcgtgcacg accggcccgg cctgcccacg cggctgctcg cccggctgac gactttgcag       660
     ggcgcttcac tccccgcacc gaaaggcccg ctccgatga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page