(data stored in ACNUC7421 zone)

EMBL: AE006468.ACCA

AE006468.ACCA        Location/Qualifiers
FT   CDS_pept        273044..274003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="STM0232"
FT                   /product="acetylCoA carboxylase, carboxytransferase
FT                   component, alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="acetyl-coenzyme A carboxylase carboxyl transferase
FT                   subunit alpha. (SW:ACCA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19196"
FT                   /db_xref="GOA:P0A1C3"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1C3"
FT                   /protein_id="AAL19196.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLEGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA"
     atgagtctga atttccttga ttttgaacag ccgatagcag agctggaagc gaaaatcgat        60
     tctctgactg cggtaagccg ccaggatgag aaactggata ttaatatcga tgaagaagtc       120
     catcgcctgc gcgaaaaaag cgtagaactg acgcgcaaaa tcttcgccga tctcggcgca       180
     tggcaggtag cccaactggc gcgccatccg cagcgtccgt acaccctgga ttatgtccgt       240
     ctggcgtttg atgagtttga tgagctggcg ggcgatcgcg cctatgctga tgacaaagcc       300
     atcgtcggcg gtatcgcgcg tctggaaggg cgaccggtga tgatcattgg tcatcagaaa       360
     ggtcgtgaaa ccaaagaaaa aattcgtcgt aactttggca tgccagcgcc ggaaggctac       420
     cgcaaagcgc tgcgcctgat ggaaatggct gaacgcttca acatgccgat tatcaccttc       480
     atcgacaccc cgggtgcata ccctggcgtg ggcgcggaag agcgtggtca gtctgaagcc       540
     atcgcccgca acctgcgtga gatgtctcgt ctgaacgtac cggtcatctg caccgtgatt       600
     ggcgaaggcg gctccggcgg cgcattggcg attggcgtgg gtgataaagt gaatatgctg       660
     caatacagca cctattccgt tatctccccg gaaggttgcg cctctatttt gtggaagagc       720
     gccgacaaag caccattggc tgctgaagcg atgggcatca tcgcgccgcg tctgaaagag       780
     ctgaagctaa tcgattccat cattccggag ccgctgggcg gcgcgcaccg taatccggaa       840
     gcgatggcgg catcgctaaa agcgcagctg ctggaagatt tagccgatct cgatgtgtta       900
     agcaccgatg atttaaaaaa ccgtcgttac cagcgtttga tgagctacgg ttacgcctaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page