(data stored in ACNUC7421 zone)

EMBL: AE006468.AEFA

AE006468.AEFA        Location/Qualifiers
FT   CDS_pept        534529..537891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aefA"
FT                   /locus_tag="STM0478"
FT                   /product="putative small-conductance mechanosensitive
FT                   channel"
FT                   /note="similar to E. coli putative alpha helix protein
FT                   (AAC73567.1); Blastp hit to AAC73567.1 (1120 aa), 89%
FT                   identity in aa 1 - 1117"
FT                   /db_xref="EnsemblGenomes-Gn:STM0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19432"
FT                   /db_xref="GOA:Q8ZRA5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA5"
FT                   /protein_id="AAL19432.1"
FT                   /translation="MTMLQLYKRSQHFVFITISVLIILLSCQSLAFARGQTNGDLPSKA
FT                   DVQNQLDTLNKQKDLSAQDKLVQQDLIDTLATLEKIERVKEETVQLRQKVAQAPEKMRQ
FT                   ATAALNALSDVDNDDEMRKTLSALSLRQLELRVAQVLDDLQNSQNDLAAYNSQLVSLQT
FT                   QPERVQNAMYTASQQIQQIRNRLDGNNVGEAALRPSQQVLLQAQQALLNAQIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSNRLEHQLQLLQEAVNSKRLTLTEKTAQEAISPDETARI
FT                   QANPLVKQELDINHQLSQRLIVATENGNMLMQQNIKVKNWLDRALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELEDMTNRIADLRLEQFEINQQRDALFQSDAFVDKLEEG
FT                   HTSEVNDEVHDALLQVVEMRRELLDQLNKQLGNQLMMAINLQVNQQQLMSVSKNLKAIL
FT                   TQQIFWVNSNRPMDWDWLKAFPQTLKEQFSAMKITVNWQKAWPAVFIAFLAGLPLLLIA
FT                   GLIRWRLKWLKAYQQKLAAAVGSLRNDSQLNTPKAILIDLIRALPVCLIILALGLILLT
FT                   MQLNISDLLWAFSKKLAMFWLVFGLCWKVLEKEGVAIRHFGMPAQLTSHWRRQIVRISL
FT                   ALLPLHFWSVVAELSPLNLMDDVLGQAVIFLNLLVITLLVWPLCRESWRDKESHGIRLV
FT                   TVTILSIIPVALMVLTATGYFYTTLRLAGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPQEEPTIALEQINQQTLRITMLLMLALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGSEAGAAVVKSVTMGSLLFAIIAAMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYVIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGTYSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLSDTTTRLVIRLGVAYGSDLEKVKRVLLQAAMEHPKVMHDPEPAVFFTTFGAS
FT                   TLDHELRLYVRELRDRSHTVDELNRAIDRLCRENDINIAFNQLEVHLHNAKGDEVTEVK
FT                   RDLNGGDLAPTAS"
     atgactatgt tgcagcttta taaacgttca cagcattttg tttttattac aattagcgtc        60
     cttattatcc tgctgtcctg tcagtctctg gcatttgccc gggggcaaac gaatggcgac       120
     ctgccgtcaa aagcggatgt gcaaaaccag ctggatacgc tgaataagca aaaagatctc       180
     tccgcccagg ataagctcgt ccagcaggac cttattgata cgttagctac gctggagaaa       240
     atcgagcggg tgaaagagga gaccgtacag ctacggcaga aggtggcgca ggcgcctgaa       300
     aaaatgcgtc aggcgacggc tgcgttgaat gcgctgagcg acgtcgataa tgatgatgaa       360
     atgcgaaaaa cgctgagtgc gctttcgcta cgtcagcttg agctgcgcgt ggcgcaggta       420
     ctggatgatt tgcaaaattc gcaaaacgat cttgccgctt ataacagcca gcttgtttcg       480
     ctacagaccc agcctgagcg cgtgcaaaac gccatgtata ccgcctcaca gcaaatacag       540
     caaatccgta accgtcttga cggcaataac gtcggcgaag ctgcgcttcg ccccagccaa       600
     caggtgttat tacaggcaca acaggcgctg cttaatgcgc agatcgacca gcaacgcaag       660
     agtcttgaag gaaataccgt tttgcaggac accctgcaaa aacagcggga ttacgtgacg       720
     gccaacagta atcgccttga acatcagctt caacttttac aggaggcggt caacagtaaa       780
     cgacttacgc taacggaaaa aacggcccag gaggccattt cgccggacga aacggcgcgt       840
     atccaggcaa acccgctggt aaaacaggaa ctggatatta accatcaact cagccagcgt       900
     ctgattgtcg cgaccgaaaa cggcaatatg ttgatgcagc aaaacattaa agtaaaaaac       960
     tggctcgatc gcgcgctgca gtcggaaaga aatatcaaag aacagattgc cgtcttaaaa      1020
     ggcagcctgt tgctgtcgcg tattctttat caacagcagc aaactctgcc ctccgccgac      1080
     gaactcgaag atatgaccaa ccgcattgcg gatttgcgtc tggagcagtt tgaaatcaac      1140
     cagcagcgtg atgccttatt ccaaagcgat gcctttgtcg acaagctgga ggaggggcat      1200
     accagcgagg tgaatgatga agttcatgat gcgttgcttc aggtggtgga gatgcgccgt      1260
     gagctattgg atcagctaaa taaacagttg ggtaaccagc tgatgatggc gattaacctg      1320
     caagttaacc agcagcagtt gatgagcgtc tcgaaaaatc tgaaagccat tttgacgcag      1380
     cagatttttt gggtgaacag taaccgccct atggactggg actggcttaa agcgttcccc      1440
     caaacgttaa aagagcaatt cagcgccatg aaaatcacgg tgaactggca aaaagcctgg      1500
     cccgcggtat ttattgcttt tttggccggg ttgccgctct tgctcatcgc cggtttaatc      1560
     cgctggcgtc tgaaatggtt aaaagcgtat caacagaagc tggccgccgc cgtgggatcg      1620
     ctgcgtaacg atagtcagct caatacgcca aaagctattc tgatcgatct gatccgcgcg      1680
     ctgccggtgt gcctgattat cctcgcgctt ggactgatcc tgctgaccat gcagctaaat      1740
     atcagcgatc tgctctgggc ctttagtaaa aagctcgcga tgttctggct ggtctttggg      1800
     ctgtgctgga aggtgctgga aaaagagggc gtggcgatac gccattttgg tatgccggcg      1860
     cagttgacca gccactggcg tcgccagatt gtacgcatta gcctcgcatt gctgccgctg      1920
     cacttttggt ctgtggtggc ggagttgtcg ccgctgaatc tgatggatga cgtgctgggg      1980
     caggcggtta ttttcctcaa tctgctggtc ataacattgc tggtgtggcc actgtgccgg      2040
     gaaagctggc gcgataaaga atctcacggc attcgactgg tgaccgtgac gattctttcc      2100
     attattccag tggcgttaat ggtattaacg gcgaccggct atttctatac caccctgcgc      2160
     ctggcggggc gctggattga aaccgtctat ctggtcatta tctggaacct gctttatcaa      2220
     acggtgctgc gcgggttaag tgtagcggcg cgccggattg cctggcgacg cgcgctggct      2280
     cgtcgtcaga acctggtaaa agagggtgcg gaaggcgcgg agccacagga agaacccacc      2340
     atcgcgctgg agcagattaa ccagcaaaca ttacgtatca cgatgctgct aatgcttgcc      2400
     ctgtttggcg ttatgttctg ggcgatttgg tccgatttga tcaccgtatt cagctatctt      2460
     gatagcatta cgctgtggca ctacaacggc tccgaagctg gcgctgcggt ggtgaaaagc      2520
     gtgacgatgg gcagcttgct atttgccatt attgccgcga tggtggcctg ggcgctcatc      2580
     cgcaacttac ccggcctgct ggaagtgctg gtgctttcac gcctgaatat gcgccagggg      2640
     gcttcgtatg cgatcaccac gatccttaac tacgtcatta tcgctgttgg cgcgatgaca      2700
     gtattcggat cgctcggcgt ctcgtgggat aaactccagt ggctggcggc ggcgttgtcg      2760
     gtgggtctcg gctttgggct acaggagatc ttcggtaact ttgtctcggg tttaatcatc      2820
     ctcttcgaac gtccggtacg cattggcgat acggtaacga tcggcaccta ctccggcacg      2880
     gtcagtaaga ttcgtattcg cgccaccact attaccgatt ttgatcgtaa agaagtgatc      2940
     attccgaaca aagcgttcgt aacggagcgg ctaattaact ggtccctctc cgataccacg      3000
     acacgtctgg tgatccggct tggcgtggct tatggctcgg atctggagaa agtgaaaaga      3060
     gtcttgctac aggcggcgat ggagcatccg aaggtgatgc acgatccgga acctgccgta      3120
     ttcttcacca cctttggcgc cagcactctg gatcatgaac tgcgtctgta cgtgcgtgaa      3180
     ttgcgcgatc gtagccatac ggtggatgaa ctgaaccgcg cgatcgatcg actgtgccgt      3240
     gaaaatgata tcaatatcgc ctttaaccag cttgaggtgc atctgcataa cgcgaagggc      3300
     gacgaagtca ctgaagtgaa gcgcgatctc aacggcggcg atctggcacc tacggcaagc      3360
     taa                                                                    3363
//

If you have problems or comments...

PBIL Back to PBIL home page