(data stored in ACNUC7421 zone)

EMBL: AE006468.AROP

AE006468.AROP        Location/Qualifiers
FT   CDS_pept        complement(173380..174753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="STM0150"
FT                   /product="APC family aromatic amino acid transporter"
FT                   /note="similar to E. coli aromatic amino acid transport
FT                   protein (AAC73223.1); Blastp hit to AAC73223.1 (457 aa),
FT                   92% identity in aa 1 - 457"
FT                   /db_xref="EnsemblGenomes-Gn:STM0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19114"
FT                   /db_xref="GOA:P0CK99"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CK99"
FT                   /protein_id="AAL19114.1"
FT                   /translation="MMDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWASAAAFFVIINAINLTNVKVFGEMEFWFAIIKVIA
FT                   VIAMILFGAWLLFSDTAGPQATVRNLWEQGGFLPHGWTGLVMMMAIIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVSSILVS
FT                   AVVTALCVLLNYLAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQGVKTRFPA
FT                   LFYPFGNVLCLLFMAAVLIIMLMTPGMAISVWLIPVWLLILGVGYLCKEKTAKTVKAH"
     atgatggaca gtcagcagca cggcgagcag ctcaagcgcg gcctgaaaaa ccgccatatt        60
     cagcttatcg cattgggcgg cgcgataggg acaggcttgt tcctgggaag cgcctccgtt       120
     attcagtcgg cggggccagg aattatcctg ggctatgcga ttgcaggctt tattgccttt       180
     ctgattatgc gccagctggg ggagatggtg gttgaagaac cggtcgccgg ctcttttagc       240
     cacttcgcct ataaatactg gggcggcttt gccggattcg cttccggctg gaactactgg       300
     gtgctgtacg tattagttgc catggcggaa ctgaccgcag tgggtaaata tatccagttc       360
     tggtatccgg agatccccac ctgggcttct gcggcagcct tctttgtgat tatcaacgcc       420
     atcaacctga ccaacgttaa agtgttcggt gagatggagt tttggttcgc cattattaaa       480
     gtgatcgccg tcatcgctat gattctgttc ggcgcgtggt tactcttcag cgataccgct       540
     ggtccgcagg ccaccgtgcg caacctgtgg gaacagggcg gctttctgcc gcatggctgg       600
     accgggctgg tgatgatgat ggccattatt atgttttcgt tcggcggact ggagctggta       660
     gggatcaccg ccgctgaagc cgataacccg gaacagagca tccccaaagc cactaatcag       720
     gttatctatc gcatcctgat tttttatatc ggctcgctgg cggttctgct ttcgctgctg       780
     ccatggactc gcgtcaccgc cgataccagc ccatttgtcc ttatcttcca tgagctgggc       840
     gatacgtttg tcgccaatgc gctgaatatc gtggttctca ccgccgcgct atcggtttat       900
     aacagctgcg tttactgcaa cagccgtatg ctgttcggtc tggcccagca gggaaatgcg       960
     ccgaaagcgc tgctgaacgt cgacaaacgc ggcgtgccgg tgagctccat tttggtttcc      1020
     gccgtcgtga ctgcgttgtg cgtgctgctc aactacctgg ccccagagtc cgcattcgga      1080
     ctgctgatgg cgctggtggt ctccgcgctg gtcattaact gggcgatgat tagccttgcc      1140
     catatgatgt tccgtcgcgc gaaacagcag cagggcgtga aaacccgctt cccggccctg      1200
     ttttatccgt tcggcaatgt tctctgcctg ctgtttatgg cggcggtatt gatcattatg      1260
     ctgatgacgc caggtatggc gatctccgtg tggctgattc cggtatggct gctcatcctg      1320
     ggcgtcggct acctgtgtaa agaaaaaacg gcaaaaacgg tgaaagccca ctga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page