(data stored in ACNUC7421 zone)

EMBL: AE006468.BCFE

AE006468.BCFE        Location/Qualifiers
FT   CDS_pept        29433..29978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcfE"
FT                   /locus_tag="STM0025"
FT                   /product="fimbrial subunit"
FT                   /note="fimbrial subunit (gi|4959515)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18989"
FT                   /db_xref="GOA:H9L408"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:H9L408"
FT                   /protein_id="AAL18989.1"
FT                   /translation="MNRSHCALFAMGLMLCPQINASADDLAYNLEFTGTIVAQTCDIDI
FT                   SSLSQSIDLGQFAVGDFPSTGTTTKFKPFNINLKNCSRGITGAKIWFTGEPDPDNPALL
FT                   AITDTGMGSGNMLASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRP
FT                   TVTSGNATAVMYFDMQYE"
     atgaacagat cacactgcgc tctttttgcc atgggactga tgctgtgtcc acaaatcaat        60
     gccagcgctg acgacctcgc ttataacctc gaatttaccg gcactattgt ggcgcaaacc       120
     tgcgacatag atatttccag tctcagtcaa agtattgatt tagggcagtt tgcagttggc       180
     gatttcccct cgacgggaac aacgacaaaa tttaagccct ttaatatcaa cctcaaaaat       240
     tgttcccgag gaattaccgg ggcgaagatc tggtttaccg gcgaacccga tccggacaat       300
     cccgcgctac tggcgataac cgacaccggg atgggaagcg gaaacatgtt agcaagcggg       360
     gttggggtgg aaattctgaa tgatgatcag gataccatca gtatcaataa tgccgactcg       420
     gtggtctatc cgttgaaagc cggacgcaac acgctgtctt tttatattcg ctataaatcg       480
     acccggccga cggtcacgtc cgggaacgcg acggcggtca tgtatttcga tatgcagtat       540
     gaatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page