(data stored in ACNUC7421 zone)

EMBL: AE006468.BRNQ

AE006468.BRNQ        Location/Qualifiers
FT   CDS_pept        453259..454578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="STM0399"
FT                   /product="LIVCS family, branched chain amino acid
FT                   transporter system II (LIV-II)"
FT                   /note="branched-chain amino acid transport system II
FT                   carrier protein(liv-II). (SW:BRNQ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19353"
FT                   /db_xref="GOA:P0A1W8"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1W8"
FT                   /protein_id="AAL19353.1"
FT                   /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   IGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGLLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSAMPLLIYSVVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIVWPAGPISNALDAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSANGAAILHAYVQHTFGGAGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYIPLSYRTLVFILGGFSMVVSNLGLSHLIQIS
FT                   IPVLTAIYPPCIALVVLSFTRSWWHNSTRIIAPAMFISLLFGILDGIKASAFGDMLPAW
FT                   SQRLPLAEQGLAWLMPTVVMVILAIIWDRAAGRQVTSSAH"
     atgacccatc agttaaaatc gcgcgatatc atcgccctgg gctttatgac atttgcgctg        60
     ttcgttggcg caggcaatat tatctttcct cctatggtcg gtttgcaggc gggtgaacac       120
     gtctggacag ccgctattgg ctttctgatt accgccgtag ggctaccggt tcttactgtt       180
     gtggcgctgg cgaaagtcgg cggcggcgta gacagcctca gtacgccgat tggtaaagtg       240
     gcgggactcc tgctggcgac cgtttgctat ctggccgtcg ggccgttatt tgcgacgccg       300
     cgtaccgcga cggtgtcgtt tgaggtcggt atcgctccgt tgactggcga ttctgcaatg       360
     ccgttgctga tttacagcgt ggtctatttc gctatcgtta ttctggtttc cctctatccg       420
     ggtaagctgc tggatacggt agggaatttc ctggcgccgt tgaaaattat tgcgctggtc       480
     atcctgtccg tcgcggctat cgtttggcct gccggtccaa tcagcaacgc cctggacgct       540
     tatcagaatg cggccttttc taacggattt gtgaacggct atctgacgat ggatacgctg       600
     ggcgcgatgg tgtttggtat cgttattgtg aacgcggcgc gttctcgcgg cgtgaccgaa       660
     gcgcgcctgt tgacgcgtta cacggtctgg gccggcctga tggcgggcgt ggggctgacg       720
     ctgctttacc ttgccttgtt ccgcttaggt tctgacagcg cgacgctggt cgatcagtca       780
     gcgaacggcg cggcgattct tcatgcctac gttcagcata cctttggcgg cgcgggaagc       840
     ttcctgctgg cggcgctgat ctttatcgcg tgtctggtga cggcggtggg gctgacctgc       900
     gcctgcgctg agtttttcgc gcagtatatt ccgctgtctt accgcacgct ggtctttatt       960
     ctcggcggct tctctatggt ggtgtcaaac ctcggactga gccatctgat tcaaatctcc      1020
     attccggtgc tgacggctat ctatccgccg tgtatcgcac tggttgtatt aagttttacc      1080
     cgctcatggt ggcataattc cacccgtatc atcgcgccgg ccatgtttat cagtctgctt      1140
     tttggtatcc ttgacggcat caaagcatct gccttcggcg atatgctgcc agcctggagt      1200
     cagcgtttgc cgctggcgga acagggactg gcttggttga tgccaacggt ggtgatggtg      1260
     atcctggcga ttatctggga tcgcgcggcg ggtcggcagg tgacctccag cgctcactaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page