(data stored in ACNUC7421 zone)

EMBL: AE006468.BTUF

AE006468.BTUF        Location/Qualifiers
FT   CDS_pept        complement(241270..242070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="STM0206"
FT                   /product="putative cobalamin periplasmic binding protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73269.1); Blastp hit to AAC73269.1 (266 aa), 81%
FT                   identity in aa 1 - 266"
FT                   /db_xref="EnsemblGenomes-Gn:STM0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19170"
FT                   /db_xref="GOA:Q8ZRP7"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP7"
FT                   /protein_id="AAL19170.1"
FT                   /translation="MAKQMFRALVALLLTLPVWLYAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPEAQKIEQVSTWQGMNLERIVALKPDLVVAWRGGNAERQVNQLTSLGIKV
FT                   MWVDAVTIEQIADTLRQLAAWSPQPEKAQQAAQTLLNEYAALNAEYAGKAKKRVFLQFG
FT                   MNPLFTSGKGSIQHQVLTTCGGENVFADSRVPWPQVSREQVLARHPQAIIVAGKAGEIL
FT                   KIEQYWGNLLKIPVIPLNSDWFERASPRIILAAKQLCNALSQVN"
     atggctaagc aaatgttcag ggcgctggtc gccctgctgc ttacgctccc ggtgtggctt        60
     tacgctgcgc cgcgcgtcat taccctctct cccgccaata cggagctcgc ttttgccgcc       120
     gggattacgc ccgttggcgt cagcagctat tccgactacc cgcccgaagc gcaaaaaata       180
     gaacaagtct ctacctggca gggaatgaat ctggaacgca ttgtggcgct gaagccggat       240
     ctggtcgtcg cctggcgcgg cggtaatgcg gaacgccagg taaaccaact gacgtcatta       300
     ggtattaagg tcatgtgggt ggacgcggta accatcgaac agatcgccga cacgctccgt       360
     caactggccg cctggagccc gcagccggaa aaggctcagc aggcagcgca gacattgcta       420
     aacgagtacg ccgcgctcaa cgccgagtat gccggtaaag ctaaaaagcg cgtctttctt       480
     cagtttggca tgaatcctct gtttaccagt ggtaaagggt ctattcaaca tcaggttttg       540
     acgacctgcg gcggagaaaa cgtctttgct gacagccgcg tgccgtggcc gcaagtcagc       600
     cgtgagcagg tgctggcaag gcatccccag gccattatcg tggccggaaa agcgggcgaa       660
     attctcaaaa ttgaacaata ctggggaaac ctgttaaaaa ttccggttat tccgcttaac       720
     agcgactggt ttgaacgcgc aagcccgcgt attatcctcg ccgcaaaaca actctgtaat       780
     gcgctttcac aggtgaatta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page