(data stored in ACNUC7421 zone)

EMBL: AE006468.CDAR

AE006468.CDAR        Location/Qualifiers
FT   CDS_pept        246073..247230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="STM0210"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73273.1); Blastp hit to AAC73273.1 (391 aa), 95%
FT                   identity in aa 7 - 391"
FT                   /db_xref="EnsemblGenomes-Gn:STM0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19174"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRP6"
FT                   /protein_id="AAL19174.1"
FT                   /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIG
FT                   ELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKY
FT                   GELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDLNQP
FT                   RVAAVVEVDSGQLGVDSAMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNSFGRW
FT                   DAEDHRKRVEQLISRMKENGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPES
FT                   RSYFYQDLMLPVLLDSLRGGWQANELARPLVKLKAMDNNGLLRRTLTAWFRHNVQPLAT
FT                   SKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEQR"
     atggctggct ggcatcttga taccaaaatg gcgcaggata tcgtggcgcg cactatgcgc        60
     atcatcgata ccaatatcaa cgtaatggat gcccgcgggc gcattatcgg cagcggcgat       120
     cgggaacgta ttggtgaatt gcacgaaggc gcgctgttag tgctgtcgca gggccgggtt       180
     gtggatatcg acgacgccgt ggcgcgacac ctgcacgggg tgcgtcaggg gattaatctt       240
     cccttacgtc ttgagggcga aattgtcggc gtgatcggcc tcaccggcga accagagcac       300
     ctgcgtaaat atggcgaact ggtgtgtatg actgccgaaa tgatgctgga gcagtcgcgg       360
     ttaatgcacc ttttggcgca ggatagccgt ttgcgcgaag agttggtgat gaacctgatt       420
     caggccgaag aaaatacgcc ggcgctggtg gaatgggcgc agcgtttggg gatcgatttg       480
     aaccagccgc gtgtggcggc ggtggtggaa gtcgacagcg gccagcttgg cgtcgatagc       540
     gcaatggcgg aacttcagca gttgcagaat gcgcttacca cgccggagcg taacaacctg       600
     atagccattg tttctctcac cgagatggtg gtactcaaac ccgccttaaa ctcgtttggt       660
     cgttgggatg ctgaagatca tcgtaagcgc gtagagcagc ttatctcgcg catgaaagag       720
     aatggtcagc tacgttttcg cgtggcgctg ggcaattact ttaccgggcc gggcagtatt       780
     gcacgctcat accgcacggc gcgcaccacg atgatggtcg gcaaacagcg aatgccagag       840
     agccgcagct atttttatca ggatttgatg ctgccggtcc tgttagatag cctgcgtggc       900
     ggctggcagg ccaatgagct ggcgcgcccg ctggtaaaac tcaaagcgat ggataacaac       960
     gggttattac gtcggacgct gacggcgtgg tttcgccata atgtccagcc gctggcgacc      1020
     tctaaggcgc tgtttattca tcgtaacacg ctggaatatc ggctaaatcg tatttcggaa      1080
     ctgaccgggc tggatttggg aaattttgac gatcggctgt tgctgtatgt ggcgctacaa      1140
     ctggatgaac agcgttaa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page