(data stored in ACNUC7421 zone)

EMBL: AE006468.CITD2

AE006468.CITD2       Location/Qualifiers
FT   CDS_pept        69710..70003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD2"
FT                   /locus_tag="STM0059"
FT                   /product="putative citrate lyase acyl carrier protein,
FT                   gamma chain"
FT                   /note="similar to E. coli citrate lyase acyl carrier
FT                   protein (gamma chain) (AAC73718.1); Blastp hit to
FT                   AAC73718.1 (98 aa), 48% identity in aa 1 - 94"
FT                   /db_xref="EnsemblGenomes-Gn:STM0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19023"
FT                   /db_xref="GOA:Q7CR91"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR91"
FT                   /protein_id="AAL19023.1"
FT                   /translation="MKIIKDALAGTLESSDVMIRIGPSSEPGIRLELESLVKQQFGAAI
FT                   EQVVRETLAKLGVERALVSVDDKGALECILRARVQAAALRAAEQTEIQWSAL"
     atgaaaatca ttaaagatgc cctggcaggc acgctggaat ccagcgatgt gatgatcagg        60
     attggtccat ccagcgagcc aggaattcgg ctggagctag agagtctggt gaagcagcag       120
     tttggcgcgg cgattgagca ggtggtgcgc gaaacgctgg cgaagctggg cgttgaacgc       180
     gcgctggtta gcgtcgatga caaaggcgcg ctggagtgca ttttacgcgc ccgagtgcag       240
     gcggcggcgt tacgcgctgc agaacaaacg gaaattcaat ggagtgcgtt atga             294
//

If you have problems or comments...

PBIL Back to PBIL home page