(data stored in ACNUC7421 zone)

EMBL: AE006468.CITG2

AE006468.CITG2       Location/Qualifiers
FT   CDS_pept        72929..73837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG2"
FT                   /locus_tag="STM0063"
FT                   /product="putative modifier of citrate lyase protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73714.1); Blastp hit to AAC73714.1 (292 aa), 47%
FT                   identity in aa 1 - 290"
FT                   /db_xref="EnsemblGenomes-Gn:STM0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19027"
FT                   /db_xref="GOA:Q8ZRX9"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX9"
FT                   /protein_id="AAL19027.1"
FT                   /translation="MNVSVVTERRTPAYSSLAAGELNGLVARALLTEARLTPKPGLVDI
FT                   RNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVMLRPLGMACENDML
FT                   QATNGVNTHRGAIFAFGLLSAAIGRLLARGEPLEQNRICDQVARLSRNIVAHELSAKKA
FT                   GKLTKSETHFQCYGLSGARGEAESGFRTVRTQALPVFNRVVQEHDDTHLALLQTLLHLM
FT                   AWNDDTNLVSRGGLEGLYYVQQQAQKLLWQGGVLVEGGIEAMQSLDDELILRNLSPGGS
FT                   ADLLAVTWFLSHFPAGSLYPE"
     atgaacgtga gcgttgtgac tgaacggcgt acgccagcgt actcatcgct ggcggctggc        60
     gaacttaatg ggttggttgc aagagcgctg ctgacggaag ccaggctgac accaaaaccc       120
     ggtctggtcg atattcgtaa ttcgggagcg catagggata tggatctggc ggcatttgaa       180
     cgtagcacta ccgccattgc tccgtggatg gaaaagtttt ttatcatggg caacaacacg       240
     gcggcgctgg cggcagaaaa tgtcctggtg atgctgcgtc cgctggggat ggcctgtgag       300
     aacgatatgc tacaggcgac caatggtgtg aatacccatc gcggggcgat tttcgctttt       360
     ggcctgctga gcgcagcgat tggccgactt ctcgcgcggg gagaaccgtt ggagcaaaat       420
     cgtatctgcg accaggttgc ccgcctgagt cggaatattg ttgcccacga gctctcagca       480
     aaaaaagcgg gaaaactgac aaagagtgaa acccatttcc agtgttatgg cctgtcgggc       540
     gcgcggggag aagcggaaag cggttttcga accgtcagaa cgcaggcttt gccggtgttt       600
     aaccgggtcg tgcaggagca tgacgatacc catcttgccc tactgcaaac attgttgcat       660
     ctgatggcgt ggaatgatga taccaatctg gtgtcacggg gaggcctgga agggctttac       720
     tacgtgcagc agcaggcaca aaaattgttg tggcaagggg gcgtattggt tgaggggggc       780
     attgaagcga tgcagtccct cgatgatgaa ctcatcctgc gtaacttaag ccctggcggt       840
     agcgcggatt tactggcagt gacctggttt ttaagtcatt ttcctgccgg ttccctctat       900
     cctgagtaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page