(data stored in ACNUC7421 zone)

EMBL: AE006468.CLPP

AE006468.CLPP        Location/Qualifiers
FT   CDS_pept        503211..503834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="STM0448"
FT                   /product="proteolytic subunit of clpA-clpP ATP-dependent
FT                   serine protease"
FT                   /EC_number="3.4.21.92"
FT                   /note="heat shock protein F21.5; similar to E. coli
FT                   ATP-dependent proteolytic subunit of clpA-clpP serine
FT                   protease, heat shock protein F21.5 (AAC73540.1); Blastp hit
FT                   to AAC73540.1 (207 aa), 99% identity in aa 1 - 207"
FT                   /db_xref="EnsemblGenomes-Gn:STM0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19403"
FT                   /db_xref="GOA:P0A1D7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1D7"
FT                   /protein_id="AAL19403.1"
FT                   /translation="MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
     atgtcataca gcggagaacg agataatttg gcccctcata tggcgctggt gccgatggtc        60
     attgaacaga cctcacgcgg tgagcgctct tttgatatct attctcgtct acttaaggaa       120
     cgcgtcatat ttctgaccgg ccaggtcgaa gaccatatgg ctaacctgat cgtggcgcag       180
     atgctgttcc tggaagcgga aaacccggaa aaagatatct atctgtacat taattctcct       240
     ggcggcgtaa ttactgcggg gatgtccatc tatgacacca tgcagtttat taagccagac       300
     gtcagcacca tttgtatggg acaggcggcc tctatggggg cgtttctgct gactgccggg       360
     gcgaaaggca aacgtttctg cttgccgaac tctcgcgtca tgatccacca gccgctgggc       420
     ggctaccagg gccaggcgac ggatattgaa attcacgccc gcgaaatttt gaaagtaaaa       480
     gggcgcatga atgaacttat ggcgcatcat acgggtcaat ctcttgagca gattgaacgt       540
     gatactgagc gcgatcgctt cctctccgcg cctgaagcgg tagagtacgg tttggttgac       600
     tcaattttga cccatcgtaa ttga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page