(data stored in ACNUC7421 zone)

EMBL: AE006468.CUEO

AE006468.CUEO        Location/Qualifiers
FT   CDS_pept        196532..198142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="STM0168"
FT                   /product="putative multicopper oxidase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73234.1); Blastp hit to AAC73234.1 (516 aa), 80%
FT                   identity in aa 1 - 516"
FT                   /db_xref="EnsemblGenomes-Gn:STM0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19132"
FT                   /db_xref="GOA:Q8ZRS2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRS2"
FT                   /protein_id="AAL19132.1"
FT                   /translation="MLRRDFLKYSVALGVASALPLWSRAAFAAERPALPIPDLLTADAS
FT                   NRMQLIVKAGQSTFAGKNATTWGYNGNLLGPAVQLHKGKSVTVDIHNQLAEDTTLHWHG
FT                   LEIPGIVDGGPQGIIPAGGTRTVTFTPEQRAATCWIHPHKHGKTGRQVAMGLAGLVLIE
FT                   DDEIRKLRLPKQWGIDDVPVIIQDKRFSADGQIDYQLDIMTAAVGWFGDTLLTNGAIYP
FT                   QHSAPKGWLRLRLLNGCNARSLNIAASDNRPLYVIASDGGLLAEPVKVTELPLLMGERF
FT                   EVLVDISDGKAFDLVTLPVSQMGMAIAPFDKPHPVMRIQPLRITASGTLPDTLTTMPAL
FT                   PSLEGLTVRNLKLSMDPRLDMMGMQMLMKKYGAQAMSGMDHDSMNAHMQGGNMGHGEMD
FT                   HGNMDHSGMNHGAMGNMNHGGKFDFHNANFINGQVFDMNKPMFAAQKGRHERWVISGVG
FT                   DMMLHPFHIHGTQFRILSENGKAPAAHRTGWKDTVRVEGGISEVLVKFDHDAPKEHAYM
FT                   AHCHLLEHEDTGMMLGFTV"
     atgttacgcc gtgatttctt aaaatattca gtggcgctgg gggttgcatc agcgctgccg        60
     ctgtggagcc gcgccgcttt tgccgccgaa cgtcccgcgt tgcctattcc tgacctgtta       120
     acggcagatg cgagcaaccg tatgcagtta attgttaaag ccggacagtc gacattcgcc       180
     ggtaagaacg cgacaacctg gggctacaac ggtaatttgc tggggccagc ggtacagctt       240
     cacaaaggaa aaagcgtgac cgttgatatc cataaccaac tggccgaaga cacgacgctt       300
     cactggcatg gtctggagat tccgggcatc gtcgacggcg gcccgcaggg gattattccc       360
     gcaggcggaa cccgcacggt gacgtttacg ccggagcaac gcgccgcgac ctgctggatt       420
     catccgcaca aacacggcaa aaccgggcgc caggtggcga tgggccttgc cgggctggtg       480
     ctgattgaag atgacgagat tcgcaaattg cgcctgccga aacagtgggg catcgacgat       540
     gtgccggtga tcattcagga caaacgcttc tccgccgatg gccagattga ttatcaactg       600
     gatattatga ccgccgccgt cggctggttt ggcgatacgc tgctgaccaa tggcgctatc       660
     tatccgcagc attccgcgcc gaaaggctgg ctacgtctgc gcttgctaaa tggctgtaat       720
     gcgcgctcgc tgaatatcgc cgccagcgat aatcgcccgc tttatgtgat cgccagcgac       780
     ggcggcctgc tggcggagcc ggtgaaagtc accgaactgc cgttattaat gggcgagcgt       840
     tttgaagtgc tggtggatat cagcgacggg aaagcctttg atctggtgac cctgccggtc       900
     agccagatgg gaatggcgat cgctccgttt gataaaccgc atccggtgat gcgtatccag       960
     ccgctgcgga ttaccgcctc cggtacgctg ccggatacgt tgacgacgat gccggcgctg      1020
     ccgtcgctgg aagggctgac ggtgcgcaac ctgaaactgt cgatggaccc gcgccttgat      1080
     atgatgggga tgcaaatgct gatgaagaaa tatggcgctc aggcgatgag cggcatggat      1140
     catgacagca tgaacgcgca tatgcagggc ggcaatatgg ggcatggcga gatggatcat      1200
     ggcaacatgg atcacagcgg gatgaatcat ggcgcgatgg gcaatatgaa tcacggcgga      1260
     aaattcgact tccataacgc taactttatc aacggccagg tcttcgatat gaacaaaccg      1320
     atgttcgcgg cgcaaaaagg ccgacatgaa cgttgggtga tttccggcgt gggtgacatg      1380
     atgctgcatc ctttccatat tcatggcacc cagttccgta ttttgtcaga gaacggcaaa      1440
     gcgccagcgg cgcacagaac gggctggaag gatacggtac gcgttgaggg cggtatcagc      1500
     gaagtgctgg tcaagttcga tcacgacgcg ccgaaggaac atgcctatat ggcgcactgt      1560
     catctgttag aacatgaaga tacgggaatg atgttaggat ttacggtctg a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page