(data stored in ACNUC7421 zone)

EMBL: AE006468.CYOA

AE006468.CYOA        Location/Qualifiers
FT   CDS_pept        complement(497192..498148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="STM0443"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /EC_number="1.10.2.-"
FT                   /note="similar to E. coli cytochrome o ubiquinol oxidase
FT                   subunit II (AAC73535.1); Blastp hit to AAC73535.1 (315 aa),
FT                   95% identity in aa 1 - 315"
FT                   /db_xref="EnsemblGenomes-Gn:STM0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19398"
FT                   /db_xref="GOA:Q7CR26"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR26"
FT                   /protein_id="AAL19398.1"
FT                   /translation="MRLRKYNKSLGWLSLIAGTALLSGCNSALLDPKGQIGLEQRSLIL
FT                   TAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLA
FT                   VLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYF
FT                   KVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKA
FT                   IATKDRAEFDQWVAKAKQSPNTMNDMAAFEKVAMPSEYNKVEYFSSVKPDLFKDVINKF
FT                   MGHGKSMDMTQPEGEHSSHEGMEGMDMSHAESANSKG"
     atgagactca ggaaatacaa taaaagtttg ggatggttgt cattaattgc aggcactgca        60
     ttactcagtg gctgtaattc tgcgctgctg gatcccaaag gacagattgg actggagcaa       120
     cgttcgctga tactgacggc atttggcctg atgttgatcg tcgttattcc cgccatcttg       180
     atggctgttg gtttcgcctg gaagtatcgt gcgagtaata aggatgcgaa gtatagcccg       240
     aactggtcac actccaataa agtggaagcc gtggtctgga cggtgcctat cttaatcatc       300
     attttccttg ccgtactgac ctggaaaacc acgcacgcgc ttgaaccaag caagccgctg       360
     gcgcatgacg aaaaaccgat caccatcgaa gtggtttcca tggactggaa atggttcttc       420
     atctatccgg agcagggtat cgccaccgtc aacgagatcg ccttcccggc gaacacgccg       480
     gtttatttca aagtgacctc caactccgtg atgaactcct tctttatccc gcgtctgggt       540
     agccagattt atgccatggc cggtatgcaa acacgtttgc atctgatcgc caacgaaccc       600
     ggaacctacg atggcatctc cgccagctat agcggcccgg gcttctctgg tatgaagttt       660
     aaagctatcg ccaccaaaga ccgcgcagaa ttcgaccaat gggtcgcaaa agcgaagcag       720
     tctccgaaca ccatgaatga tatggcggcg ttcgagaaag tggctatgcc aagcgagtac       780
     aacaaggtgg aatatttctc cagcgtgaaa cctgatttgt tcaaggacgt tattaacaaa       840
     ttcatgggcc acggtaagag catggacatg acccaacctg aaggtgagca cagctcgcat       900
     gaaggaatgg aaggtatgga catgagccac gcggaatccg ccaactccaa gggttga          957
//

If you have problems or comments...

PBIL Back to PBIL home page