(data stored in ACNUC7421 zone)

EMBL: AE006468.CYOB

AE006468.CYOB        Location/Qualifiers
FT   CDS_pept        complement(495190..497181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="STM0442"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /EC_number="1.10.2.-"
FT                   /note="similar to E. coli cytochrome o ubiquinol oxidase
FT                   subunit I (AAC73534.1); Blastp hit to AAC73534.1 (663 aa),
FT                   95% identity in aa 1 - 663"
FT                   /db_xref="EnsemblGenomes-Gn:STM0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19397"
FT                   /db_xref="GOA:Q7CR27"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR27"
FT                   /protein_id="AAL19397.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAAIIVGGLAILAAITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNLSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPSVGVDYWIWALQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMMWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYVLGFMGMTRRLSQQIDPQFHTMLMVAAAGAALIALGILCQLIQIF
FT                   VSIRDRDQNRDLTGDPWGGRTLEWSTSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYQQ
FT                   PGQYEEIHMPKNSGAGIVIAAFATVFGFAMIWHIWWLAIVGFAGMIISWIVKSFDEDVD
FT                   YYVPVPEVEKLENQHFDEITKAGLKNGN"
     atgttcggaa aattatcact ggatgcagta ccgttccatg aacctatcgt catggtaacg        60
     atcgctgcaa ttatcgtcgg gggactggcg atactggcag cgattactta cttcggtaag       120
     tggacctacc tatggaaaga gtggttaacg tcggttgacc ataaacgcct cggcatcatg       180
     tatatcatcg tcgcgattgt gatgctgtta cgtggtttcg ccgatgccat catgatgcgt       240
     agccagcagg cgcttgcctc cgcaggcgaa gcgggttttc taccgccgca ccactacgat       300
     cagatcttta ccgctcacgg cgtaatcatg atcttcttcg tggcgatgcc cttcgttatc       360
     ggtctgatga acctggtggt tccgctgcag atcggcgcgc gcgacgttgc tttccctttc       420
     ctgaacaacc tgagcttctg gttcaccgtt gtcggcgtta ttctggttaa cctctcgctg       480
     ggcgtgggtg aattcgcgca gacagggtgg ctggcttatc cgccgctatc gggaatagag       540
     tacagtccta gcgtcggggt cgattactgg atatgggcgt tgcaactctc gggtattggt       600
     acgacgttaa ccggtatcaa cttcttcgtg acgatcctga agatgcgtgc gccgggtatg       660
     acaatgttca agatgccggt ctttacctgg gcctctttgt gcgccaacgt actgatcatc       720
     gcctctttcc cgattctgac ggttaccgtc gcgttgctga ccctggatcg ctatctgggc       780
     acccatttct ttaccaacga tatgggcggc aacatgatga tgtacatcaa cctgatttgg       840
     gcctggggcc atccggaagt gtacattctg attctgccgg tcttcggggt attctccgaa       900
     atcgcagcga ccttctcgcg taaacgtctg ttcggctata cctcgctggt ttgggcgacc       960
     gtctgtatta ccgtactgtc gtttatcgtt tggctgcacc acttcttcac gatgggcgcg      1020
     ggcgcgaacg ttaacgcctt cttcggtatc accaccatga ttatcgccat cccgaccggg      1080
     gtgaagatct tcaactggtt gttcaccatg tatcagggcc gtatcgtctt ccattccgca      1140
     atgatgtgga ccattggctt tatcgtgacc ttctcggtcg gcggtatgac cggcgttctg      1200
     ctggcggtac cgggcgcgga cttcgtcctg cacaacagtc tgttcctgat tgcgcacttc      1260
     cataacgtga tcatcggcgg cgtggtgttt ggctgcttcg caggtatgac ctactggtgg      1320
     ccgaaggcgt ttggcttcaa gctgaacgaa acctggggta aacgcgcctt ctggttctgg      1380
     attatcggtt tctttgtagc ctttatgccg ctgtacgtac tgggcttcat gggcatgacc      1440
     cgtcgcctca gccagcaaat tgatccgcag ttccatacga tgctgatggt tgccgccgcc      1500
     ggcgccgcgc tgattgcgct gggtatcctg tgccaactga ttcagatctt cgtttctatt      1560
     cgcgaccgcg atcagaaccg cgatctgacc ggcgacccat ggggtggccg tacgctggag      1620
     tggtcaacct cttctccgcc gccgttctat aactttgccg ttgtgccgca cgttcacgaa      1680
     cgtgacgcct tctgggaaat gaaagaaaaa ggcgaagcgt accaacagcc tggacagtat      1740
     gaagagattc atatgccgaa aaatagcggt gccggtattg ttatcgccgc cttcgcgacg      1800
     gtatttggct tcgccatgat ctggcatatc tggtggctgg cgatagtggg tttcgcaggc      1860
     atgatcatca gctggattgt aaaaagcttt gatgaagatg tggattacta cgtgccggtc      1920
     ccggaagtcg aaaaactgga aaaccagcat ttcgatgaga ttactaaggc agggctgaaa      1980
     aatggcaact ga                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page