(data stored in ACNUC7421 zone)

EMBL: AE006468.DNAE

AE006468.DNAE        Location/Qualifiers
FT   CDS_pept        269549..273031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="STM0231"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase III, alpha chain. (SW:DP3A_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19195"
FT                   /db_xref="GOA:P14567"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14567"
FT                   /protein_id="AAL19195.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTGPLVKKAASLGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVHNELLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIERDWLVELKEGLILLSGGRMGDVGRCLLRGNQALVEECVAFYEAHFP
FT                   DRYFLELIRTGRQDEETYLHAAVELAEARGLPVVATNDVRFLESDDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMTTEDYLVKKAKEGLEERLAFLFPDEEERKKRRPEYDERLDIELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLVPPDPGMTLAKAFEAEPQLPEIYEADEEVRALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   AKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREELSYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFEEGAKKNGIDGELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDEGEIVYGIGAIKGVGEGPIEAIIDARNQGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQTDMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVTTAAGLVIAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
     atgtctgaac cacgtttcgt tcacctgcgg gtgcacagcg actactctat gatcgatggg        60
     ctggcgaaga ccgggccgct ggtgaaaaag gcggcctcat taggtatgcc tgcgctggcg       120
     atcaccgatt ttaccaacct ctgcggtctg gtgaagttct acggagcggg tcatggcgcg       180
     ggcattaaac ccatcgtcgg ggcggacttt aacgttcaca acgaactgct gggagatgag       240
     ctgactcatc tgacggtact ggcggcgaat aatacgggat accagaactt gacgttgctg       300
     atctcgaaag cgtatcagcg cggctacggc gcggcaggcc cgattatcga gcgcgactgg       360
     ctggtagagc ttaaagaagg tttgatcctg ctttccggcg ggcgcatggg cgacgtaggc       420
     cgctgtctgc tacgcggcaa ccaggcgctg gtggaggagt gcgttgcttt ctatgaagcg       480
     cattttcccg atcgctactt cctggaactg atccgtaccg gcagacagga tgaagagacc       540
     tatctccatg ctgcggttga gctggctgag gcacgtggtt tgccggttgt cgcgacaaac       600
     gatgtccgtt ttcttgaaag cgatgatttt gacgcccatg agattcgtgt cgcgatccac       660
     gacggtttca cgctcgacga tcctaaacgt ccacgcaatt attcaccgca gcagtatatg       720
     cgcagtgaag aagaaatgtg cgagctgttc tccgatattc cggaggcgct ggaaaatacg       780
     gtggagattg ccaaacgctg caacgtaacg gtgcgtctgg gtgaatattt cttgccgcag       840
     ttcccgaccg gcgatatgac caccgaagat tatctggtca aaaaagcgaa agaggggctg       900
     gaagagcgtc tggctttcct gtttccggac gaagaagagc gcaaaaagcg tcgcccggaa       960
     tatgacgagc gtctggatat tgaactacag gttatcaacc agatggggtt ccctggctac      1020
     ttcctcatcg tgatggagtt tatccagtgg tcaaaagata acggcgtgcc ggtagggccg      1080
     ggacgtggtt ccggggctgg ttcgctggtg gcctacgcgc tgaaaattac cgaccttgat      1140
     ccgctggaat ttgacctgct gttcgaacgt ttcctgaacc cggaacgtgt ctcgatgcct      1200
     gacttcgacg ttgacttctg tatggagaaa cgcgaccagg tgattgaaca cgtcgcagat      1260
     atgtacgggc gtgatgcggt atcgcaaatt atcaccttcg gtacgatggc ggcgaaagcc      1320
     gttatccgcg atgtgggccg cgtgctgggg catccgtacg gttttgtcga tcgtatctcg      1380
     aagctggtgc cgcccgatcc gggcatgacg ctggcaaaag cctttgaagc ggaaccgcaa      1440
     ctgccggaaa tttacgaggc ggatgaagag gtcagagcgc tgatcgatat ggcgcgtaag      1500
     ctcgaaggcg tcacgcgtaa cgccggtaag cacgctggcg gcgtggtcat cgcgccgacc      1560
     aaaattaccg actttgcgcc gctgtactgc gatgaagagg gcaagcatcc ggttacccag      1620
     tttgataaaa gcgacgtgga atatgccggg ctggtgaagt tcgacttcct cggtttgcgt      1680
     acgctgacta tcatcaactg ggcgctggag atgatcaaca agcggcgggc gaagaatggc      1740
     gagccaccgc tggatatcgc tgccattccg ctggacgata aaaaaagctt cgacatgctg      1800
     cagcgctcgg aaaccacggc ggtcttccag cttgaatcgc gcggcatgaa agatctgatc      1860
     aaacgtctgc agccggactg ctttgaagat atgatcgcgc tggtggccct gttccgtccc      1920
     ggcccgttgc agtcagggat ggtagataac ttcatcgacc gtaagcacgg tcgtgaagaa      1980
     ctctcttacc cggacgttca gtggcagcat gaaagcctga agccggtact ggagccgacc      2040
     tacggcatca ttctgtatca ggaacaggtg atgcagattg cccaggtact ttccgggtat      2100
     actctcggcg gcgcggatat gctgcgtcgt gcgatgggta agaaaaagcc ggaggagatg      2160
     gccaaacagc gttccgtttt tgaagaaggc gcgaaaaaga acggtatcga cggcgaactg      2220
     gcgatgaaaa tctttgacct ggtggagaaa ttcgccggtt acgggtttaa caaatcgcac      2280
     tccgccgctt atgcgctggt ttcttaccag acgctatggc taaaggcgca ctatccggca      2340
     gagtttatgg cggcggtgat gactgccgat atggacaaca ccgagaaggt cgtcggcctg      2400
     gtggacgagt gctggcggat gggactgaaa attctgccgc cggatattaa ctccgggttg      2460
     taccatttcc acgttaatga tgagggcgag atcgtctacg gtattggcgc gatcaaaggc      2520
     gtcggcgaag gtccgatcga agcgatcatc gacgcgcgta atcagggcgg ctatttccgc      2580
     gagctgtttg atctgtgcgc gcggaccgac accaaaaagc tcaaccgccg ggtgctggaa      2640
     aagctgatca tgtccggggc gttcgaccgc ctggggccgc accgcgccgc gctgatgaac      2700
     tcattgggcg atgcgctgaa agccgccgac cagcacgcca aagcggaagc tatcggtcag      2760
     acggatatgt tcggcgtgct ggcggaagag ccggagcaaa tcgaacaatc ctatgccagc      2820
     tgccagccgt ggccggagca ggtggtgtta gatggggaac gtgaaacgtt ggggctgtac      2880
     ctgacgggcc accctatcaa tcagtattta aaagaaattg agcgctatgt cggcggggta      2940
     aggctcaaag acatgcatcc gacagaacgt ggtaaagtca ccacggctgc ggggctcgtg      3000
     attgccgcaa gggttatggt caccaagcgc ggcaatcgta tcggcatctg tacgctggat      3060
     gaccgttccg ggcgtctgga agtgatgtta tttaccgacg cgctggataa ataccagcag      3120
     ttgctggaaa aagaccgcat acttatcgtc agcggacagg tcagctttga tgacttcagc      3180
     ggggggctta aaatgaccgc ccgcgaagtg atggatattg acgaagctcg cgaaaaatac      3240
     gctcgcgggc ttgctatctc gctgacggac aggcaaattg atgaccagct tttaaaccga      3300
     ctccgtcagt ctctggaacc ccaccgctcg gggaccattc cagtacatct ctactatcag      3360
     agggcggatg cgcgtgcgcg gctgcgtttt ggcgcaacgt ggcgtgtctc tccgagcgat      3420
     cgtttactta acgatctgcg tggcctcatt ggttcggagc aggtggaact ggagtttgac      3480
     taa                                                                    3483
//

If you have problems or comments...

PBIL Back to PBIL home page