(data stored in ACNUC7421 zone)

EMBL: AE006468.DNAK

AE006468.DNAK        Location/Qualifiers
FT   CDS_pept        11593..13509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="STM0012"
FT                   /product="chaperone Hsp70"
FT                   /note="DNAK protein; heat shock protein 70; HSP70; involved
FT                   in DNA biosynthesis and cell division; (SW:DNAK_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18976"
FT                   /db_xref="GOA:Q56073"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q56073"
FT                   /protein_id="AAL18976.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAWLD
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDTRLINYLVDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVR
FT                   DAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALNALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDDDVVDAEFEEVK
FT                   DKK"
     atgggtaaaa ttattggtat cgacctgggt actaccaact cttgtgtagc gattatggat        60
     ggaacgcagg cacgcgtgct ggagaacgcc gagggcgatc gcactacgcc ttctatcatt       120
     gcttataccc aggatggtga aactctggtt ggtcagccgg ctaaacgtca ggcagtgaca       180
     aacccgcaaa acaccctgtt tgcgattaaa cgcctgattg gccgccgctt ccaggacgaa       240
     gaagttcaac gtgacgtttc tatcatgccg tacaaaatca tcggcgccga caacggcgac       300
     gcatggcttg atgtgaaagg tcagaaaatg gcgccgccgc agatttctgc cgaagtgctg       360
     aagaaaatga agaaaacggc tgaagattat ctgggcgaac cggtaactga agcggttatc       420
     accgtaccgg cttactttaa cgatgcgcag cgtcaggcaa ccaaagatgc tggtcgtatc       480
     gcggggctgg aagttaaacg tatcatcaac gaaccgactg ccgcagcgct ggcttacggt       540
     ctggataaag aagtcggcaa ccgtactatc gcggtttacg acctcggtgg tggtactttc       600
     gatatctcta ttatcgaaat cgacgaagtt gatggcgaaa aaacctttga agttctggca       660
     accaacggtg atacccacct gggtggtgaa gacttcgata cccgcctgat caactacctc       720
     gttgacgagt ttaagaaaga tcagggcatt gacctgcgta acgatccgct ggccatgcag       780
     cgcctgaaag aagccgcaga aaaagccaaa atcgagctgt cttctgcgca gcagaccgac       840
     gtgaacctgc cgtacattac cgcagatgcc accggtccga aacacatgaa catcaaagtg       900
     actcgtgcga aactggaaag cctggttgaa gatctggtga accgttctat cgagccgctg       960
     aaagtcgcac tgcaggacgc tggcctgtcc gtgtctgata tcaacgacgt gatcctcgtt      1020
     ggcggtcaga cccgtatgcc aatggtgcag aaaaaagtgg ctgagttctt tggtaaagag      1080
     ccgcgtaaag acgttaaccc ggacgaagct gtggctatcg gcgcagcggt acagggcggc      1140
     gtgttgaccg gtgatgtgaa agacgtactg ctgctggacg ttaccccgct gtctctgggt      1200
     atcgaaacga tgggtggcgt gatgactccg cttatcacca aaaacaccac catcccgacc      1260
     aagcacagcc aggtgttctc tactgcggaa gacaaccagt ctgcggtaac catccatgtg      1320
     ctgcagggtg agcgtaagcg tgcgtctgat aacaaatctc tgggtcagtt caacctggat      1380
     ggcatcaacc cggcgccgcg cggtatgccg cagatcgaag tcaccttcga tatcgatgct      1440
     gacggtatcc tgcacgtctc cgcgaaagat aaaaatagcg gtaaagagca gaagatcact      1500
     atcaaggcgt cttctggtct gaacgaggaa gaaattcaga aaatggttcg cgatgcagaa      1560
     gcgaacgctg aatccgaccg taagttcgaa gagctggttc agacccgtaa ccagggcgac      1620
     catctgctgc acagcacccg taagcaggtt gaagaagcag gcgataaact gccggctgat      1680
     gacaaaaccg ctatcgagtc tgccctgaac gcgctggaaa ctgccctgaa aggcgaagat      1740
     aaagccgcta tcgaagcgaa aatgcaggaa ctggcgcagg tttcccagaa actgatggaa      1800
     atcgctcagc agcaacatgc gcagcagcag gctggctccg ctgacgcttc tgcaaacaac      1860
     gcgaaagatg acgacgttgt cgacgctgag tttgaagaag taaaagataa aaaataa         1917
//

If you have problems or comments...

PBIL Back to PBIL home page