(data stored in ACNUC7421 zone)

EMBL: AE006468.DNAQ

AE006468.DNAQ        Location/Qualifiers
FT   CDS_pept        303403..304134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="STM0264"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="3-5 exonucleolytic proofreading function; DNA
FT                   polymerase III, epsilon chain. (SW:DP3E_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19221"
FT                   /db_xref="GOA:P0A1G9"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1G9"
FT                   /protein_id="AAL19221.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPVFADVVDEFLDYIRGAELVIHNASFDI
FT                   GFMDYEFGLLKRDIPKTNTFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMTFAMEGETQRQQGEATIQRIVRQASRLRVVFASEEEL
FT                   AAHESRLDLVQKKGGSCLWRA"
     atgagcactg caattacacg acagattgtc ctcgataccg aaaccaccgg tatgaatcag        60
     ataggcgcgc actatgaagg tcacaagatt attgagatcg gtgcggttga ggtgataaac       120
     cgtcgtctga ccggcaacaa ttttcatgtt tacctgaagc ccgatcgcct tgtcgatcca       180
     gaggcttttg gcgtacacgg tattgccgat gagtttctgc tggataagcc ggtttttgct       240
     gatgtggtcg atgagtttct tgattatatc cgcggcgcgg agctggtcat ccataacgca       300
     tcgttcgata tcggctttat ggattatgag tttggtctgc ttaaacgcga tattcctaaa       360
     accaatactt tctgcaaagt taccgacagc ctggcgttgg cgcggaaaat gttccccggc       420
     aagcgtaaca gccttgatgc actgtgttcg cgttatgaga tagataatag caaacgtact       480
     ttgcacggcg cattgctcga tgcccagatc cttgctgaag tgtatctggc gatgacgggc       540
     ggacaaacgt ccatgacgtt tgcgatggaa ggagagacgc aacggcagca aggtgaggcg       600
     accattcagc gaatcgttcg ccaggccagc cggttacggg tcgtttttgc ctctgaggaa       660
     gagctggctg cgcatgaatc gaggcttgat ctggtgcaga aaaagggcgg aagttgcctt       720
     tggcgggcgt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page