(data stored in ACNUC7421 zone)

EMBL: AE006468.DNAX

AE006468.DNAX        Location/Qualifiers
FT   CDS_pept        540910..542838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="STM0484"
FT                   /product="DNA polymerase III, tau and gamma subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA elongation factor III; DNA polymerase III
FT                   subunit TAU [contains: DNA polymerase III subunit gamma].
FT                   (SW:DP3X_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19438"
FT                   /db_xref="GOA:P74876"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P74876"
FT                   /protein_id="AAL19438.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLSRAADGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAVVDANGERVMSLINEAAARGIEWEAL
FT                   LVEMLSLLHRIAMVQLSPAALGSDMAAIEQRMRELARTVPPGDLQLYYQTLLIGRKELP
FT                   WAPDRRMGVEMTLLRALAFHPRMPLPEPETPRQSFAPVAPTAVMTPPQLQQPSAPAPQT
FT                   SPAPLPASTSQVLAARNQLQRAQGVTKTKKSEPAAASRARPVNNSALERLASVSERVQA
FT                   RPAPSALETAPVKKEAYRWKATTPVVQTKEVVATPKALKKALEHEKTPELAAKLAAEAI
FT                   ERDPWAAQVSQLSLPKLVEQVALNAWKEQNGNAVCLHLRSTQRHLNSSGAQQKLAQALS
FT                   DLTGTTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELD
FT                   EESIRPI"
     atgagttatc aggtcttagc cagaaaatgg cgcccacaaa cctttgctga cgtcgtcggc        60
     caggaacatg tgctgaccgc actggcgaac ggcttgtcgt tagggcgcat tcatcacgca       120
     tatctttttt ccggcacgcg cggcgtcggt aaaacctcta tcgcccggct gctggcgaag       180
     gggctgaact gcgaaaccgg tattaccgcg acgccgtgcg gcgtttgcga taactgtcgg       240
     gaaattgagc aggggcgttt tgtcgatctc attgagattg acgccgcatc gcgtaccaaa       300
     gtcgaagaca cccgcgacct gctggataac gtccagtacg cgcctgcgcg cggtcgcttt       360
     aaagtctatc tgatcgatga agtccacatg ctgtcgcgcc acagctttaa tgcgctactt       420
     aaaacgcttg aagaaccgcc agcgcatgtg aaatttttac tggcgaccac cgatccgcag       480
     aagctgccgg tgaccatttt gtcgcgctgc ctacagtttc atctcaaagc gctggatgtt       540
     gaacagattc gccatcagct tgagcatatt ctcaatgagg aacatatcgc tcacgaaccc       600
     cgcgcgttgc agttgttatc gcgtgcggct gacggcagcc tgcgcgatgc attaagtctg       660
     actgaccagg cgatcgccag cggcgacggg caggtttcga cgcaggcggt aagcgccatg       720
     ctcggtacgc tggacgacga ccaggctttg tcattagttg aggcggtggt tgacgctaac       780
     ggcgaacgcg tcatgtcgct tatcaacgag gcggcggcgc gcggtattga atgggaagcg       840
     ctgctggtcg aaatgcttag cctgctgcac cgtattgcga tggtgcaact ttcgcctgcc       900
     gcgttaggca gcgatatggc ggctatcgag caacggatgc gcgaacttgc ccggacggtg       960
     cctcccggcg atcttcagct ctattatcag acgttgttga ttggtcgcaa agaattgccc      1020
     tgggcgccgg accggcggat gggcgttgaa atgacgttac tgcgtgcact ggcgtttcac      1080
     ccgcgtatgc ccttgccgga gcctgaaacg ccgcggcagt cttttgcgcc cgtggcccca      1140
     acggcggtaa tgacgccgcc gcagctgcag cagccgtcgg cgcccgcgcc gcagacatcg      1200
     ccagcgccgc tgccggcgtc taccagtcag gtgctggcgg cgcgcaatca gctacagcgc      1260
     gcgcagggag taaccaaaac aaaaaagagt gaaccggcag ccgcatcccg cgcgcggccg      1320
     gtgaataact ctgcgctgga gcggctggcc tcggtttcgg agcgcgtaca ggcgcgcccg      1380
     gcgccgtccg cgctggaaac ggcgccagta aagaaagagg cttatcgctg gaaggccacc      1440
     acgccggtag tacaaaccaa agaagtggtg gctacgccaa aagcgcttaa gaaagctctg      1500
     gagcatgaaa aaacgccgga gctggcggct aaactggcgg cggaagcgat tgagcgcgat      1560
     ccgtgggcgg cgcaggtaag ccagctttct ttgcctaagc tggtggagca ggtggcgctt      1620
     aatgcctgga aggagcagaa cggcaacgcg gtttgtctgc atctgcgttc gacgcagcgg      1680
     cacctcaatt ccagcggcgc gcagcaaaag ctggcgcaag cgctcagcga tctgacggga      1740
     acgacggttg aactgaccat cgttgaagat gataatcccg cggtgcgtac gccgctggaa      1800
     tggcgtcagg ccatttatga agagaaactc gcgcaagcgc gtgagtcaat tattgcggat      1860
     aataacattc agacgctgcg tcgattcttc gacgccgagc tggatgaaga gagtatccgc      1920
     cccatttga                                                              1929
//

If you have problems or comments...

PBIL Back to PBIL home page