(data stored in ACNUC7421 zone)

EMBL: AE006468.FABZ

AE006468.FABZ        Location/Qualifiers
FT   CDS_pept        266537..266992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="STM0227"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase. (SW:FABZ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19191"
FT                   /db_xref="GOA:P0A1H9"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1H9"
FT                   /protein_id="AAL19191.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
     ttgactacta acactcatac tctgcagatt gaagagattt tagagcttct gccgcaccgt        60
     tttccgtttt tactggtcga tcgcgtgctg gactttgaag aaggtcgttt tctgcgtgcg       120
     gtgaaaaatg tctccgtcaa cgagccgttt ttccaggggc atttcccggg caaaccgatt       180
     ttgccaggcg tgctgattct ggaagcgatg gcgcaggcaa ccggtattct ggcgtttaaa       240
     agcgttggta aactggaacc tggcgaactg tattatttcg cgggtattga tgaagcgcgc       300
     tttaagcgtc cggtggtgcc aggcgatcag atgatcatgg aagtcacttt cgagaaaacg       360
     cgccgtggcc tgacccgctt taaaggggtt gcgctggtcg acggtaaagt cgtgtgcgaa       420
     gcaaccatga tgtgtgctcg tagccgggag gcctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page