(data stored in ACNUC7421 zone)

EMBL: AE006468.FTSA

AE006468.FTSA        Location/Qualifiers
FT   CDS_pept        154360..155622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="STM0132"
FT                   /product="ATP-binding cell division protein"
FT                   /note="septation process protein; complexes with FtsZ;
FT                   associated with junctions of inner and outer membranes;
FT                   similar to E. coli ATP-binding cell division protein,
FT                   septation process, complexes with FtsZ, associated with
FT                   junctions of inner and outer membranes (AAC73205.1); Blastp
FT                   hit to AAC73205.1 (420 aa), 99% identity in aa 1 - 420"
FT                   /db_xref="EnsemblGenomes-Gn:STM0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19096"
FT                   /db_xref="GOA:Q7CR80"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR80"
FT                   /protein_id="AAL19096.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
     atgatcaagg cgacggacag aaaactggta gtaggactgg agattggcac cgcgaaggtt        60
     gccgctttag taggggaagt tctgcccgac ggtatggtca atatcattgg cgtgggcagt       120
     tgcccatcgc ggggtatgga taaaggcggg gtgaatgacc ttgagtcagt ggtgaaatgc       180
     gttcagcgcg ccattgacca ggcggaattg atggccgatt gccagatctc ctcggtatat       240
     ctggcgcttt ccggcaaaca tattagctgt cagaatgaaa ttggtatggt gcccatttcc       300
     gaagaggaag tgacgcaaga agatgtggaa aacgtcgtgc atactgcgaa gtcagtgcgc       360
     gtgcgcgatg aacatcgcgt gctgcatgtg attcctcagg agtacgccat tgactaccag       420
     gaaggcatta aaaatccggt cggtctttcc ggcgtgcgta tgcaggcgaa agtacatttg       480
     attacctgcc acaacgatat ggcaaaaaac attgtcaaag ctgttgaacg ttgtggtctg       540
     aaagttgacc aactgatatt tgccggactg gcggccagtt attccgtgtt aacggaagat       600
     gaacgtgaac tgggcgtctg tgtcgtggat atcggcggtg gtacaatgga tatcgccgtt       660
     tatactggcg gcgcgctgcg tcataccaaa gtgatccctt acgcggggaa cgtggtgacc       720
     agcgatatcg cttatgcctt tggtacgccg ccgagcgatg ctgaagccat taaagttcgc       780
     cacggttgcg cgctgggttc cattgtcggt aaagacgaga gcgttgaagt accgagcgta       840
     ggcgggcgtc cgccgcgcag cctgcaacgc cagacgctgg cggaagtgat tgagccgcgt       900
     tacaccgagc tgctcaatct ggtcaacgaa gagatattgc aattacagga acagcttcgc       960
     caacaagggg taaaacatca cctggcggcg gggattgtgt taaccggcgg cgcggcgcaa      1020
     atcgaagggc ttgctgcttg cgctcagcgc gtgtttcata cgcaggtgcg tatcggcgcg      1080
     ccgctgaata tcaccggtct gacggattat gcccaggagc cgtattactc aacggcggtg      1140
     ggattgcttc actacgggaa agagtcccac ttaaacggtg aagcagaagt ggaaaaacgt      1200
     gttacggcat cagttggctc gtggatcaag cgacttaata gctggctgcg aaaagagttt      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page