(data stored in ACNUC7421 zone)

EMBL: AE006468.FTSL

AE006468.FTSL        Location/Qualifiers
FT   CDS_pept        141345..141710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="STM0121"
FT                   /product="cell division protein"
FT                   /note="ingrowth of wall at septum; similar to E. coli cell
FT                   division protein; ingrowth of wall at septum (AAC73194.1);
FT                   Blastp hit to AAC73194.1 (121 aa), 98% identity in aa 1 -
FT                   121"
FT                   /db_xref="EnsemblGenomes-Gn:STM0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19085"
FT                   /db_xref="GOA:Q7CR84"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR84"
FT                   /protein_id="AAL19085.1"
FT                   /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     atgatcagca gagtgacaga agccctaagc aaagtgaagg gatcgatagg aagcaacgag        60
     cgccatgcct tgcctggcgt gatcggtgac gatcttttgc ggttcgggaa gctgccactc       120
     tgcttgttca tttgcatcat tttaacggcg gtgacggtgg tcacgacggc gcaccatact       180
     cgtttactca ccgcgcagcg tgaacaattg gttctggagc gcgatgcatt ggacattgaa       240
     tggcgcaacc tgatccttga agaaaatgcg ctcggcgatc acagccgggt ggagcggatc       300
     gcaacggaaa agctgcaaat gcagcatgtt gatccgtccc aagaaaatat tgtagtgcaa       360
     aaataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page