(data stored in ACNUC7421 zone)

EMBL: AE006468.FTSZ

AE006468.FTSZ        Location/Qualifiers
FT   CDS_pept        155683..156834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="STM0133"
FT                   /product="tubulin-like GTP-binding protein and GTPase"
FT                   /note="forms circumferential ring in cell division; similar
FT                   to E. coli cell division; forms circumferential ring;
FT                   tubulin-like GTP-binding protein and GTPase (AAC73206.1);
FT                   Blastp hit to AAC73206.1 (383 aa), 98% identity in aa 1 -
FT                   383"
FT                   /db_xref="EnsemblGenomes-Gn:STM0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19097"
FT                   /db_xref="GOA:Q8ZRU0"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRU0"
FT                   /protein_id="AAL19097.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVLDRYQ
FT                   QHGMAPLTQEQKTVAKVVNDNTPQAAKEPDYLDIPAFLRKQAD"
     atgtttgaac ctatggaact aaccaacgac gcggtgatta aagtcatcgg cgtcggtggt        60
     ggcggcggta acgctgttga acacatggtg cgcgagcgca tcgaaggtgt tgaattcttc       120
     gcggtgaata ccgacgctca ggcgttgcgt aaaacggcgg ttggccagac cattcaaatt       180
     ggtagcggca ttaccaaagg tctgggcgct ggcgctaacc cggaagtcgg tcgtaacgcg       240
     gcggacgaag accgtgaagc gctgcgtgcg gcgcttgaag gcgcagacat ggtatttatc       300
     gcggcaggca tgggcggcgg taccggaacc ggcgcggcgc cagtggttgc tgaagtggca       360
     aaagatttag gtattctgac cgttgccgtg gtgactaagc ctttcaattt tgaaggcaaa       420
     aagcgcatgg catttgcgga gcagggtatc accgagctgt ccaagcatgt ggactcgttg       480
     atcaccatcc cgaacgacaa gctgctgaaa gtgctgggcc gtggtatctc cctgctcgac       540
     gcgttcggcg cggctaacga cgtgctgaaa ggcgcggttc agggcatcgc agagctgatc       600
     acccgcccgg gtctgatgaa cgtcgacttt gctgacgtgc gtaccgtgat gtctgaaatg       660
     ggctacgcaa tgatgggctc cggcgtggcg agcggtgaag accgtgcgga agaagcggct       720
     gaaatggcta tttcttctcc gctgctggaa gatatcgacc tgtccggcgc gcgcggcgtg       780
     ttggtcaaca ttactgcggg cttcgacctg cgtctggatg agttcgaaac cgtcggtaac       840
     accatccgtg cctttgcatc ggataacgcc accgtggtta tcggtacttc tctggacccg       900
     gatatgaacg acgaactgcg cgtgaccgtt gttgccactg gaattggtat ggacaagcgt       960
     cctgaaatca ctctggtcac caataaacag gtgcagcagc cggtgttgga tcgttatcag      1020
     cagcacggta tggcgccgct gacgcaggag caaaaaacgg tcgcgaaagt ggttaacgac      1080
     aatacaccac aggcggcgaa agagccggat tatctggata tccccgcatt cctgcgtaag      1140
     caagctgatt aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page