(data stored in ACNUC7421 zone)

EMBL: AE006468.GLND

AE006468.GLND        Location/Qualifiers
FT   CDS_pept        complement(250144..252816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="STM0214"
FT                   /product="uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="[protein-PII] uridylyltransferase. (SW:GLND_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19178"
FT                   /db_xref="GOA:P23679"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23679"
FT                   /protein_id="AAL19178.1"
FT                   /translation="MNTLPEQHANTALPTLPDQPQNPGVWPRAELTVAGIKARIDIFQH
FT                   WLGEAFDSGICAEQLIEARTEFIDQLLQRLWIEAGFGQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVATNLI
FT                   ETRLLIGDVALFLALQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTPAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNDPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPVDDEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRNSAITGIYSTTLRH
FT                   LRHARRHLSQPLCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFAKEETRQRHPLCVDLWPRLPHPELILIAALFHDIA
FT                   KGRGGDHSVLGAQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTETRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEAALHKIWTRCRANYFVRHSPNQLAWHARHLLQHDLRQ
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLAADRHDVIRTGLEQTITQRSWQPPQPRRQPAKLRHFTVETEVNFLPTHTD
FT                   RKSFMELIALDQPGLLARVGQIFADLGISLHGARITTIGERVEDLFIIATADRRALNNV
FT                   LQLEVQQRLTAALNPNDKG"
     atgaatactc ttcctgaaca gcacgcgaat accgcactcc ccaccctccc tgaccagccg        60
     caaaaccctg gcgtctggcc gcgcgctgaa ctgaccgtcg ccggtatcaa agcccgcatc       120
     gacatctttc aacactggct gggagaggca tttgacagcg gcatttgtgc tgaacagctt       180
     attgaagccc gaaccgaatt tatcgaccag ttattgcaac gcctgtggat tgaggccggt       240
     ttcggtcaga ttgccgatct ggcgctggtc gctgtcggcg gctatggacg cggcgaactg       300
     catccgcttt ccgatattga tctgctcatt ttaagccgca aaaagctgcc cgatgaacag       360
     gcgcaaaagg tcggcgagct gctgacttta ttatgggacg tcaagctgga tgtcgggcat       420
     agcgtacgta cgctggaaga gtgtctgctg gaaggtctgt ctgatttaac cgttgcgaca       480
     aacctcatcg aaacgcgcct gctgatcggt gatgtcgctc tgtttctggc actgcaaaaa       540
     catattttca gcgaaggttt ttggccgtcc gacaaatttt acgccgccaa agtagaagag       600
     cagaaccagc gccaccagcg ctatcacggt accagctata atctggagcc ggatattaaa       660
     agcagccccg gcggcctgcg cgatatccat acgttacagt gggtcgcccg acgtcacttc       720
     ggcgctacct cgctcgatga gatggtggga ttcggctttt taacccccgc tgagcgcgcg       780
     gagctcaacg agtgcctgca tatcctgtgg cgcattcgct ttgcgctaca tctggtggtc       840
     agccgctacg ataaccgcct gctgttcgac cgccagttaa gcgtcgctca acgccttaac       900
     tacagcggcg agggcaatga tccggttgag cggatgatga aagactactt ccgggttacg       960
     cgtcgggtga gcgaacttaa tcagatgctg cttcagctat ttgacgaggc gattctggcg      1020
     ctacctgcgg atgaaaaacc acgtcctgtt gacgatgagt ttcaactgcg cggcacgctt      1080
     attgatctgc gtgacgacac gctgtttatc cgcgaaccgc aagcgatcct gcgcatgttt      1140
     tatatgatgg tgcgcaatag cgcgatcacc ggcatctact ctacgacgtt acgccacttg      1200
     cgccacgccc gccgccacct gagccaaccg ctgtgttaca tcccggaggc gcgcactctg      1260
     tttctgagta tgctgcgcca tcccggcgcg gtcagccgcg gcctgctgcc catgcatcgc      1320
     cacagcgtac tgtgggctta tatgccgcag tggtcgcaca tcgtcggaca aatgcagttt      1380
     gacctgttcc acgcatacac ggtggatgaa cacaccatcc gcgtaatgct caaactggag      1440
     agctttgcga aagaagagac gcgccagcgc catccgctat gcgtcgatct ctggccgcgg      1500
     cttccccatc cggaactgat cctgatcgcc gcgctgttcc acgatattgc gaaaggacgc      1560
     ggcggcgacc attccgtact gggcgcgcag gatgtactca ccttcgccga actgcacggt      1620
     ttgaactcac gcgaaacgca actggtcgcg tggctggtgc gccaacacct gctaatgtca      1680
     gtcaccgccc agcgccgcga catccaggat ccggaagtca tcaagcagtt tgccgaagag      1740
     gtgcaaaccg aaacacggct gcgttttctg gtctgcctga ccgtcgcgga catctgcgcg      1800
     accaacgaaa ccttgtggaa tagctggaaa cagagcctgc tgcgcgagct gtacttcgcc      1860
     actgaaaaac agctcaggcg tggaatgcaa aatacgccgg atatgcgtga gcgcgtgcgt      1920
     caccatcagc ttcaggcgct ggcgctgctg cgaatggaca atattgatga agccgcgctg      1980
     cacaaaatct ggacccgctg tcgcgctaac tattttgttc gtcatagtcc aaatcagctc      2040
     gcctggcacg cacgccattt attgcagcac gatctgcgcc aaccgttagt gttgctcagt      2100
     ccgcaggcca cgcgcggtgg aaccgaaatt tttatctgga gtccggacag accctatctg      2160
     tttgccgccg tctgcgccga gctggacagg cgtaatttaa gcgtccatga cgcgcagatc      2220
     tttaccactc gcgacggcat ggcaatggat acgtttattg ttctggaacc agacggcagc      2280
     ccgctggcgg cggatcgcca tgacgttatt cgcaccggtc ttgaacaaac cattacgcag      2340
     cgtagctggc agccgccgca gccgcgtcgg caaccggcaa agttacggca ctttacggtc      2400
     gaaacggaag tcaattttct gcccacccat accgacagaa aatcattcat ggaattgatc      2460
     gcgctcgatc aacctggtct gctggccagg gtcggacaaa tttttgccga tctgggaatt      2520
     tcgcttcatg gcgcccgaat tacaaccatt ggtgaacgag tagaagattt attcataatc      2580
     gccacagcgg atcggcgcgc acttaataat gtgctgcaac ttgaggtgca acaacggttg      2640
     acagcggccc tcaatccaaa cgataaaggg tag                                   2673
//

If you have problems or comments...

PBIL Back to PBIL home page