(data stored in ACNUC7421 zone)

EMBL: AE006468.GLNK

AE006468.GLNK        Location/Qualifiers
FT   CDS_pept        520527..520865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="STM0462"
FT                   /product="regulatory protein P-II 2"
FT                   /note="nitrogen assimilation by glutamine synthetase;
FT                   regulates GlnL (NRII) and GlnE (ATase); similar to E. coli
FT                   nitrogen regulatory protein P-II 2 (AAC73553.1); Blastp hit
FT                   to AAC73553.1 (112 aa), 97% identity in aa 1 - 112"
FT                   /db_xref="EnsemblGenomes-Gn:STM0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19417"
FT                   /db_xref="GOA:Q7CR20"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR20"
FT                   /protein_id="AAL19417.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLEEVIDIISKAAYTGKIGDGKIFVAELMRVIRIRT
FT                   GEADEAAL"
     atgaagctgg ttaccgtgat tatcaaaccg ttcaagctgg aggacgtgcg ggaggcgctt        60
     tcttccattg gcattcaggg actgaccgtc accgaagtga aagggtttgg ccgtcagaaa       120
     ggacacgccg aactgtatcg cggcgcggag tacagcgtga atttcctgcc gaaggtcaaa       180
     attgatgtgg ctatcgccga cgaccaactg gaagaggtga tcgatatcat cagtaaagcg       240
     gcttacaccg gaaaaattgg cgacggcaaa attttcgtcg cggagctcat gcgcgttatt       300
     cggattcgta ccggcgaagc tgacgaagca gcgctgtaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page