(data stored in ACNUC7421 zone)

EMBL: AE006468.GSK

AE006468.GSK         Location/Qualifiers
FT   CDS_pept        549000..550304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="STM0491"
FT                   /product="inosine-guanosine kinase"
FT                   /EC_number="2.7.1.73"
FT                   /note="similar to E. coli inosine-guanosine kinase
FT                   (AAC73579.1); Blastp hit to AAC73579.1 (434 aa), 94%
FT                   identity in aa 1 - 434"
FT                   /db_xref="EnsemblGenomes-Gn:STM0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19445"
FT                   /db_xref="GOA:Q8ZRA0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRA0"
FT                   /protein_id="AAL19445.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQIQPEQETNASWVVGIDQTLVD
FT                   IEAKVDDDFITRYGLSAGHSLVIEDEVAEKLYQELTRENLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQAVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEAVIAGASALVLTSYLVRCKPGEPMPDATMKAIEYAKKHNVP
FT                   VVMTLGTKFVIADNPQWWQAFLKENVSILAMNEEEAEALTGENDPLLAADKALDWVDLV
FT                   LCTAGPIGLYMAGFTEEEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCINPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
     atgaaatttc ccggtaaacg taaatccaaa cactattttc ccgtcaatgc gcgtgacccg        60
     ttgttgcaac aaattcagcc agaacaggaa accaacgcct cctgggtcgt cggtatcgac       120
     cagacgttgg tggatattga ggcgaaagtg gatgacgatt ttattacacg ctatggatta       180
     agcgccgggc attctctggt gatagaagac gaggtggcgg agaagctgta tcaggaactg       240
     acgcgggaaa atctgatcac ccatcagttt gctggcggca ccataggcaa tacgatgcac       300
     aattactcgg tactggcgga tgaccgttcg gtgttactgg gcgtgatgtg cagcaacatt       360
     gagattggca gctacgctta tcgctacctg tgtaatactt ccagccgtac cgacctgaat       420
     tatctgcaag cggtagatgg cccgattggc cgctgtttca cgctgattgg cgaatccggc       480
     gagcgtacct tcgctatcag ccccggccat atgaatcagt tacgggcgga aagtattccg       540
     gaagcggtga tcgctggcgc ttccgcgctg gtgttgacct catatctggt gcgctgtaag       600
     cctggcgaac cgatgcctga cgcgacgatg aaagcgatcg aatacgcgaa aaagcataac       660
     gtgccggttg tcatgacgct gggcaccaaa tttgtgatcg ccgataatcc gcagtggtgg       720
     caggcgtttc tcaaagagaa tgtctcgatt ctggcaatga atgaagaaga agcggaagcg       780
     ctgaccggcg aaaacgaccc gctgctggcg gcggataagg cgctggactg ggtcgacctg       840
     gtgttatgca ccgccgggcc gatagggtta tatatggcgg gcttcaccga agaggaagca       900
     aaacgtaaaa cccagcatcc gctgctaccg ggagctattg ctgaatttaa ccagtatgaa       960
     tttagccggg caatgcgcca taaagattgt attaatccgc tgcgcgttta ttcgcatatt      1020
     gcgccgtata tgggcgggcc ggaaaaaatc atgaacacca acggcgcggg cgatggcgcg      1080
     ctggcggcgc tgctgcacga tattacggcg aacagttacc atcgtagcaa cgtaccgaac      1140
     tccagtaagc acaaatttac ctggctgacc tattcgtcgc tggcgcaggt gtgtaaatat      1200
     gctaaccgtg tcagttatca ggtactgaac cagcattctc cgcgtctgac acgcgggctg      1260
     ccggaacgtg aggacagcct ggaagagtcg tactgggatc gctaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page