(data stored in ACNUC7421 zone)

EMBL: AE006468.HOFC

AE006468.HOFC        Location/Qualifiers
FT   CDS_pept        complement(165127..166329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="STM0142"
FT                   /product="putative component in type IV pilin biogenesis"
FT                   /note="similar to E. coli putative integral membrane
FT                   protein involved in biogenesis of fimbriae, protein
FT                   transport, DNA uptake (AAC73217.1); Blastp hit to
FT                   AAC73217.1 (400 aa), 67% identity in aa 1 - 400"
FT                   /db_xref="EnsemblGenomes-Gn:STM0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19106"
FT                   /db_xref="GOA:Q8ZRT4"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRT4"
FT                   /protein_id="AAL19106.1"
FT                   /translation="MSVKQLWRWQGVNDKGQLEQDVVWADNRLALIITLQHQRIMPLRI
FT                   KRMGVNAALWKEEQSAEIIHQLATLIHAGLTLSEGLELLAKQHPHRQWQALLRTLAHEL
FT                   EQGVPFSSALVSWPQVFPPLYQTMIRTGELTGKLAECCFELARQQKAQRQITVSVKKAL
FT                   RYPAIILTMAALVVFAMLHFVLPEFAAIYRSFNTPLPLLTRGIIAIAQWGSAWGWLILF
FT                   LTMLVAIAHRRVKQKPSWQAQRQRLLLRLPVMGRLIRGQKLAQIFTVLALTQSAGIPFL
FT                   QGLESAIDSLGCPYWSQRLTQVHQEIAAGNPVWLALKNTQEFSPLCLQLVRTGEASGSL
FT                   DIMLHNLARHHSETTLALADNLASLLEPALLIITGLIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     atgagcgtta aacagctctg gcgctggcaa ggcgttaacg ataaaggtca actggaacaa        60
     gacgttgtat gggcggacaa tcgtctggcg ctgatcatca ccctgcaaca tcagcgcatt       120
     atgccgcttc gcatcaagcg catgggcgtt aacgccgcac tgtggaaaga agagcaaagc       180
     gctgaaatta ttcatcagtt ggccacgctc attcatgccg ggctgacgct ttcagaaggg       240
     ctggaactcc ttgcgaaaca gcatccccac cgacaatggc aagcgctgtt gcgcacgctg       300
     gctcacgagc ttgaacaggg cgtccctttt tccagcgcat tagtctcctg gccgcaggta       360
     tttccgccgc tctaccagac gatgatccgc accggagaac tgaccggcaa actggccgaa       420
     tgctgctttg aactggcccg tcagcaaaaa gcgcaacggc agattacggt tagcgtgaaa       480
     aaggcgctgc gctatcccgc cattattcta acaatggccg ccctggtcgt tttcgccatg       540
     ctgcactttg tcctgccgga atttgccgcc atttaccgta gcttcaatac cccgcttcct       600
     cttctgacac gcggtattat tgcgatagcg caatgggggt cggcatgggg ttggctcatc       660
     ttgttcctga cgatgctcgt tgctatcgct caccgcaggg taaaacaaaa gccgtcctgg       720
     caagcgcagc ggcagcgtct tctgctacgg cttcccgtta tgggtcgcct gataagaggc       780
     cagaaactag cgcaaatatt caccgtactg gcattaaccc aaagcgcagg tattcctttt       840
     cttcagggac tggaaagcgc tatcgatagt ctcggctgcc cttactggtc acagcgttta       900
     acgcaggtac atcaggagat cgccgcgggc aatccggtct ggttggcgct aaaaaatacc       960
     caggaattta gtccgctatg cctgcaactg gtcagaacgg gcgaagcgtc cggttcactc      1020
     gatatcatgc tgcataacct tgcccgtcac cacagtgaaa ctacgctggc gctggccgat      1080
     aatctggcgt cgctgttgga accggcgtta ttgatcatca ccggcttaat tatcggtacg      1140
     ctggtagtgg cgatgtattt gccgattttt catctgggag acgcgatgag cgggatggga      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page