(data stored in ACNUC7421 zone)

EMBL: AE006468.IMP

AE006468.IMP         Location/Qualifiers
FT   CDS_pept        complement(105810..108170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="STM0093"
FT                   /product="organic solvent tolerance protein"
FT                   /note="similar to E. coli organic solvent tolerance
FT                   (AAC73165.1); Blastp hit to AAC73165.1 (784 aa), 91%
FT                   identity in aa 1 - 784"
FT                   /db_xref="EnsemblGenomes-Gn:STM0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19057"
FT                   /db_xref="GOA:Q8ZRW0"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="PDB:4N4R"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRW0"
FT                   /protein_id="AAL19057.1"
FT                   /translation="MKKRIPTLLATMIASALYSHQGLAADLASQCMLGVPSYDRPLVKG
FT                   DTNDLPVTINADNAKGNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKQAEGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTKNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLTQ
FT                   AGEGVMELDYLPSDKVYEDDHPKEGDKHRWLFYWQHSGVMDQVWRFNVDYTKVSDSSYF
FT                   NDFDSKYGSSTDGYATQKFSVGYAVQNFDATVSTKQFQVFNDQNTSSYSAEPQLDVNYY
FT                   HNDLGPFDTRIYGQAVHFVNTKDNMPEATRVHLEPTINLPLSNRWGSLNTEAKLMATHY
FT                   QQTNLDSYNSDPNNKNKLEDSVNRVMPQFKVDGKLIFERDMAMLAPGYTQTLEPRVQYL
FT                   YVPYRDQSGIYNYDSSLLQSDYNGLFRDRTYGGLDRIASANQVTTGVTTRIYDDAAVER
FT                   FNVSVGQIYYFTESRTGDDNIKWENDDKTGSLVWAGDTYWRISERWGLRSGVQYDTRLD
FT                   SVATSSSSLEYRRDQDRLVQLNYRYASPEYIQATLPSYYSTAEQYKNGINQVGAVASWP
FT                   IADRWSIVGAYYFDTNSSKPADQMLGLQYNSCCYAIRVGYERKLNGWDNDKQHAIYDNA
FT                   IGFNIELRGLSSNYGLGTQEMLRSNILPYQSSM"
     atgaaaaaac gtattcccac tcttctggcc accatgatcg ccagcgccct ttatagtcat        60
     caggggctgg cagccgatct cgcctcacag tgtatgttgg gcgtgccgag ctacgatcgt       120
     cctctggtaa aaggcgatac caacgatctg ccggttacta tcaatgccga taacgctaaa       180
     ggtaactacc cggacgatgc cgtttttacc ggcaacgtgg acattatgca ggggaatagc       240
     cgcctgcaag cggatgaagt gcagcttcat cagaagcagg cggaaggtca gccggaacct       300
     gtacgcaccg tcgatgcgct gggtaatgtg cattatgatg acaatcaggt catccttaaa       360
     gggccgaagg gctgggcgaa cctgaacacc aaagacacga acgtctggga aggcgattac       420
     cagatggtgg gccgtcaggg gcgcggtaaa gccgatctca tgaagcagcg cggcgaaaac       480
     cgctatacca ttctggaaaa cggcagcttt acctcctgtc tgcctggctc cgatacctgg       540
     agcgtggtgg ggagtgaagt catccatgac cgcgaagaac aggttgcgga gatctggaac       600
     gcccggttta aagtaggtcc ggttccgatc ttttatagcc cctatttaca gctacccgtc       660
     ggtgacaagc gtcgctcagg tttcctgatc ccgaacgcga aatacacgac caagaactat       720
     ttcgagttct acttaccgta ttactggaac atcgcgccca atatggacgc caccatcacc       780
     ccgcactata tgcaccgccg cggcaatatt atgtgggaga acgaattccg ttatctcacg       840
     caggcaggcg agggagtgat ggaattagat tatctgcctt ctgataaagt ctacgaggac       900
     gatcacccca aagagggcga taagcaccgc tggttattct actggcagca ctcaggcgtg       960
     atggatcagg tgtggcgttt taacgtcgat tacaccaaag tcagcgactc cagctacttt      1020
     aacgatttcg acagtaagta cggttccagt accgacggct acgcaacgca gaaattcagc      1080
     gtcggctacg ccgtacaaaa ctttgacgct acggtgtcga ccaaacaatt ccaggtcttt      1140
     aacgatcaaa acaccagcag ctattcagcg gagccgcagt tagacgttaa ctactaccat      1200
     aacgatctcg gcccgtttga tacccggatt tacggccagg cggtgcactt tgttaacacc      1260
     aaagacaata tgccggaagc gacccgcgtc cacctggagc caaccatcaa tttgccgctc      1320
     tccaaccgct ggggcagcct gaacaccgaa gcgaagctga tggcgacgca ctatcagcaa      1380
     acgaatctgg acagctataa cagcgatcca aacaataaaa ataagctgga agattcggtt      1440
     aaccgcgtca tgccgcagtt taaagtcgac ggtaagctca tcttcgaacg cgatatggcg      1500
     atgctggcgc cggggtatac ccagacgctg gaaccacgcg tgcagtacct gtatgtgccg      1560
     taccgcgacc agagcggcat ctataactac gattcttctt tgctgcaatc cgactataac      1620
     ggcctgttcc gcgaccgcac ttatggcggt ctcgaccgta ttgcttccgc caaccaggtc      1680
     acaaccggcg tcacaacacg catttatgat gatgccgccg ttgaacgttt taacgtttct      1740
     gttggtcaaa tctactattt cacggagtct cgcaccggcg atgacaacat taaatgggag      1800
     aatgacgaca aaaccggttc gctggtttgg gcaggcgaca cttactggcg tatttcagaa      1860
     cgctgggggc tgcgtagcgg agtgcagtac gatacccgtc tggatagcgt cgctaccagc      1920
     agcagcagcc tcgaataccg tcgggatcag gatcgtctgg tacagttgaa ctaccgctat      1980
     gccagcccgg aatatattca ggctacgttg ccttcgtatt attccacggc agagcagtat      2040
     aaaaacggca tcaatcaggt gggcgcggtg gcaagttggc cgattgccga tcgctggtcg      2100
     attgtcggcg cgtactactt cgataccaat tcgagcaaac ctgcagacca gatgctcggc      2160
     ttgcagtaca actcttgctg ctatgcgatc cgcgtcggat acgaacgtaa gctgaacggt      2220
     tgggataacg ataaacaaca cgcgatttat gataacgcga ttggcttcaa cattgagctg      2280
     cgcggtttga gctctaacta cggcctcggc acgcaagaaa tgttgcgttc gaacattctg      2340
     ccgtaccaaa gctctatgta a                                                2361
//

If you have problems or comments...

PBIL Back to PBIL home page