(data stored in ACNUC7421 zone)

EMBL: AE006468.LIGT

AE006468.LIGT        Location/Qualifiers
FT   CDS_pept        complement(217751..218281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="STM0188"
FT                   /product="2'-5' RNA ligase"
FT                   /EC_number="6.5.1.-"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73258.1); Blastp hit to AAC73258.1 (179 aa), 77%
FT                   identity in aa 4 - 177"
FT                   /db_xref="EnsemblGenomes-Gn:STM0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19152"
FT                   /db_xref="GOA:Q8ZRQ5"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRQ5"
FT                   /protein_id="AAL19152.1"
FT                   /translation="MSEPKRLFFAIDLPDDARAQIIAWRAAHFASEDGRPVAAANLHLT
FT                   LAFLGDVSSDKQRALAQLAGRIRQPGFTLHLDDAGQWLRSRVVWLGMRQPPRGLLQLAN
FT                   MLRAQAARSGCYQSPQPFHPHITLLRDASHTVAIPPPGFCWSFPVTSFALYASSYGQGR
FT                   TRYAELQRWTLGE"
     atgtctgagc caaaacggct gttttttgcg attgacttac ccgacgacgc gcgcgcgcaa        60
     attatcgcct ggcgcgccgc ccattttgcg tctgaagacg gacgccccgt ggcagcggcg       120
     aacctgcacc tgacgctggc ctttttaggc gacgtcagta gcgataagca gcgcgcgctt       180
     gcgcaactgg ccggacgaat tcgacagccg ggctttacgc tacatctgga tgacgccggt       240
     cagtggctgc gttcgcgcgt ggtgtggctg gggatgcgcc agccgccgcg cgggttgttg       300
     cagttggcta atatgctgcg cgcgcaggcc gcccgcagcg gttgttacca aagcccgcag       360
     ccttttcacc cgcatattac gctgctgcgc gacgccagcc atacggtggc tatcccgccg       420
     ccgggctttt gctggtcatt tccggtcacg tcgtttgcgc tttacgcctc ttcgtatggg       480
     caaggccgta cccgctatgc cgagctgcag cgctggacgc tgggcgaata a                531
//

If you have problems or comments...

PBIL Back to PBIL home page