(data stored in ACNUC7421 zone)

EMBL: AE006468.LPDA

AE006468.LPDA        Location/Qualifiers
FT   CDS_pept        181007..182431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="STM0154"
FT                   /product="lipoamide dehydrogenase (NADH)"
FT                   /EC_number="1.8.1.4"
FT                   /note="component of 2-oxodehydrogenase and pyruvate
FT                   complexes; L protein of glycine cleavage complex second
FT                   part; similar to E. coli lipoamide dehydrogenase (NADH);
FT                   component of 2-oxodehydrogenase and pyruvate complexes;
FT                   L-protein of glycine cleavage complex (AAC73227.1); Blastp
FT                   hit to AAC73227.1 (474 aa), 98% identity in aa 1 - 474"
FT                   /db_xref="EnsemblGenomes-Gn:STM0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19118"
FT                   /db_xref="GOA:Q8ZRT0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRT0"
FT                   /protein_id="AAL19118.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVITQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRVW
FT                   DSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNPKAKKK"
     atgagtactg aaatcaaaac tcaggtcgtg gtacttgggg cgggcccggc aggctattct        60
     gccgctttcc gttgcgctga tttaggtctg gaaaccgtaa ttgtagaacg ctacaacacc       120
     cttggcggtg tttgtctgaa cgtcggctgt atcccttcta aagcgctgct gcacgtagca       180
     aaagttatcg aagaagccaa agcgctggct gaacacggta tcgtcttcgg tgagccgaaa       240
     accgatatcg acaagattcg tacctggaaa gagaaagtga tcacgcagct gaccggcggt       300
     ctggcgggta tggccaaagg ccgtaaagtg aaagtggtca acggtctggg taaattcacc       360
     ggggcgaaca ccctggaagt ggaaggcgaa aacggcaaaa ccgtgatcaa cttcgacaac       420
     gcgatcatcg cggcaggttc tcgtccgatc caattaccgt ttattccgca tgaagacccg       480
     cgcgtatggg attctaccga cgctctggaa ctgaaagaag tgccgaagcg tatgctggtc       540
     atgggcggcg gtatcatcgg tctggaaatg ggtaccgtat accacgcgct gggttcagag       600
     attgacgtgg ttgaaatgtt cgaccaggtt atcccggcgg ctgataaaga catcgttaaa       660
     gtcttcacca agcgcatcag caagaaattc aacctgatgc tggaaaccaa agtgactgcc       720
     gttgaagcga aagaagacgg tatctacgtt tcgatggaag gcaaaaaagc cccggctgaa       780
     gcgcagcgtt atgatgcggt tctggtggcg attggtcgtg tgccgaacgg taaaaacctc       840
     gacgcgggca aagctggcgt ggaagttgac gaccgtggct ttatccgcgt ggacaaacag       900
     ctgcgcacca acgtgccgca catcttcgct atcggcgata tcgtcggtca gccgatgctg       960
     gcgcataaag gcgttcacga aggccacgtt gccgctgaag ttatcgccgg gaagaaacac      1020
     tacttcgatc cgaaagttat cccgtctatc gcgtacaccg agccagaagt ggcatgggtt      1080
     ggcctgaccg agaaagaagc gaaagaaaaa ggcatcagct atgaaaccgc caccttcccg      1140
     tgggcagctt ctggccgtgc tatcgcttct gactgtgcag acggtatgac caaactgatt      1200
     ttcgacaaag aatctcaccg cgtgatcggc ggggcgattg tcggtaccaa cggcggcgag      1260
     ctgctgggtg aaatcggtct ggcgatcgaa atgggctgtg acgcggaaga catcgcgctg      1320
     accattcatg cgcacccgac tctgcacgag tccgtcggtc tggctgctga agtgttcgaa      1380
     ggtagtatta ccgacctgcc gaacccgaaa gcgaagaaga aataa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page