(data stored in ACNUC7421 zone)

EMBL: AE006468.PE15

AE006468.PE15        Location/Qualifiers
FT   CDS_pept        16088..16432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0015"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18979"
FT                   /db_xref="GOA:Q8ZS12"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS12"
FT                   /protein_id="AAL18979.1"
FT                   /translation="MSIPNHVSTTEVVLLELEILLTIISIGAWGGFVSYLLRKDKTEYN
FT                   SSHESIKYCLTQIVISCFTSFLLSAIAIEKECSFNIVLLAAGLGGVFASPILKILGRRI
FT                   KKIIEGNNSD"
     atgtctattc ccaaccatgt gtcgacaacg gaagttgtgc tattggagct agagatctta        60
     ctcactatta tttcgattgg cgcgtgggga ggctttgtca gctatctttt acgcaaagat       120
     aagacagaat ataatagttc tcatgaaagt attaaatatt gcttaacgca gatcgtgatt       180
     tcctgcttca ccagtttctt gttaagcgcg attgcgatcg aaaaagaatg cagtttcaac       240
     attgttctgt tggcggcagg cttaggcggt gttttcgcga gtccgatctt aaagattctt       300
     gggcggcgga ttaaaaaaat tatcgaaggt aataattcag attaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page