(data stored in ACNUC7421 zone)

EMBL: AE006468.PE155

AE006468.PE155       Location/Qualifiers
FT   CDS_pept        182720..183004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0155"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19119"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR75"
FT                   /protein_id="AAL19119.1"
FT                   /translation="MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMGE
FT                   DLNAQHQQITHTHEGVWAANSGSIQADEAALTSNKPPVQGHPELMPHQG"
     atgaaacttt ttctgacaac agcagcgcta actgcgacct tgatttccgg catggcattt        60
     gccagcgatc ccgtcatccc ctgggcgact aacagcggcg gtacggaaag cacgcatatt       120
     gcggcaatgg gcgaggattt gaatgcgcag catcagcaga tcacccacac gcatgaaggc       180
     gtatgggcgg ctaattccgg cagcattcag gctgatgaag ctgcgctgac cagcaacaag       240
     ccgccggtac aaggccatcc ggaattaatg ccgcatcagg gctaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page