(data stored in ACNUC7421 zone)

EMBL: AE006468.PE156

AE006468.PE156       Location/Qualifiers
FT   CDS_pept        complement(183042..183833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0156"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19120"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR74"
FT                   /protein_id="AAL19120.1"
FT                   /translation="MKKVMLSALLLSLPLLGYAQERFPSPEAAASAFAAAVAGKNETQL
FT                   TALLGDDWRQFLPPEGADPEAVARFNRDWREGHRIVQKDNTAHLNVGREDWQLPVPMVK
FT                   ETGGWRFDMAAAGNEILTRTIGRNELSTLQAMHAYVDAQQDYYLQNHRWAHRIISSEGQ
FT                   KDGLYWPTKAGDVPSPLGPNFSPAAPDEGYHGYHFRIISDNDGHGAALLAWPMHYGETG
FT                   VMSFMVNQDDRIYQADLGKETESKVQAITRFAPDAQWQVAE"
     atgaaaaagg ttatgttaag cgctctgtta ctgtcgttac ccttgctggg ctacgcgcag        60
     gaacggttcc cctccccgga agcggccgcc agcgccttcg ccgcggcggt agccggaaaa       120
     aacgaaacgc agcttaccgc gctactgggc gatgactggc ggcaatttct gccgccggaa       180
     ggtgccgatc ccgaggccgt ggcccgcttc aatcgtgact ggcgcgaagg ccatcgcatt       240
     gtacaaaaag acaatacggc gcacctgaat gtcggacgag aagactggca gctcccggtg       300
     cccatggtga aagagactgg cggctggcgc tttgatatgg cggcagccgg gaatgagatc       360
     ctcacccgta ctattgggcg aaatgaactt tctaccttac aggccatgca tgcttacgtt       420
     gatgcgcagc aggattatta cttacaaaac catcgctggg cgcacaggat aatcagtagc       480
     gaaggccaaa aagatggcct gtactggcca accaaagcag gcgacgtccc cagtccgtta       540
     ggcccaaact ttagtcccgc agcgccagac gagggttacc acggctacca tttccgtatt       600
     atcagcgata acgacggtca cggcgcggcg cttctggcct ggccgatgca ttacggcgaa       660
     accggggtga tgagttttat ggtcaaccag gacgatcgta tttatcaggc ggatttaggc       720
     aaggagacgg agagtaaagt tcaggctatc acgcgttttg cgccagacgc acagtggcag       780
     gtcgccgaat aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page