(data stored in ACNUC7421 zone)

EMBL: AE006468.PE163

AE006468.PE163       Location/Qualifiers
FT   CDS_pept        192411..193394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0163"
FT                   /product="pyridoxine phosphate biosynthetic protein"
FT                   /note="similar to E. coli pyridoxine biosynthesis
FT                   (AAC73163.1); Blastp hit to AAC73163.1 (329 aa), 37%
FT                   identity in aa 2 - 324"
FT                   /db_xref="EnsemblGenomes-Gn:STM0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19127"
FT                   /db_xref="GOA:P58718"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="PDB:2HI1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58718"
FT                   /protein_id="AAL19127.1"
FT                   /translation="METKTVAITMGDPAGIGPEIIVKALSEDGLNGAPLVVIGCLATLK
FT                   RLQAKGITPNVELRAIERVAEARFAPGIIHVIDEPLAQPEALEAGKVQAQAGDLAYRCV
FT                   KRATELALRGDVQAIATAPLNKEALHLAGHNYPGHTELLATLTHSRDYAMVLYTDKLKV
FT                   IHVSTHIALRKFLDTLSTARVETVIGIADTFLKRVGYVKPRIAVAGVNPHAGENGLFGD
FT                   EETRILTPAITDARAKGMDVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLKLLGFY
FT                   DGVNITAGLPFIRTSADHGTAFDIAWTGKAKSESMAVSIKLAMQLA"
     gtggagacta aaaccgttgc cattaccatg ggcgatccag cgggcattgg gccggaaatt        60
     attgttaaag cgctaagcga agacggtctc aacggcgcgc cgctggtggt tattggatgc       120
     ctcgcaacgt tgaaacgttt acaggcgaag ggcatcacgc cgaacgtcga gttacgggcc       180
     attgaacggg tcgccgaagc gcgttttgcg cccggcatca ttcatgtgat tgatgagccg       240
     ctggcgcagc cggaggcgct ggaggccggg aaagttcagg cgcaggcggg ggatttagcg       300
     tatcgctgcg tgaagcgcgc caccgagtta gcgttacggg gcgacgtaca ggctatcgct       360
     accgcgccgc tgaataaaga ggcgctgcac ctggcggggc acaactatcc gggccatacc       420
     gagctgctcg cgaccctgac ccatagccgc gattacgcga tggtacttta caccgataaa       480
     ctaaaagtga ttcacgtttc aacgcatatc gcgctgcgta aattccttga tacgttaagt       540
     accgcgcgtg tcgaaacggt gattggcatt gctgatactt tcctcaagcg tgtgggttac       600
     gttaaaccgc gtatcgccgt ggcaggcgtg aatcctcatg cgggcgagaa tggcctgttt       660
     ggcgatgaag agacgcgtat cctgacgcca gccattaccg atgcccgcgc aaaaggtatg       720
     gacgtttatg ggccgtgccc gccggatact gtatttctcc aggcttatga ggggcagtat       780
     gatatggtgg tggcgatgta tcatgaccag gggcatatcc cgttgaaatt gcttggcttt       840
     tatgatggcg tgaatatcac cgcggggctg ccgtttattc ggacctctgc tgatcatggc       900
     accgcatttg atatcgcctg gacgggaaaa gcaaaatctg agagcatggc cgtatcgatc       960
     aaactggcaa tgcaactggc ataa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page