(data stored in ACNUC7421 zone)

EMBL: AE006468.PE201

AE006468.PE201       Location/Qualifiers
FT   CDS_pept        236265..237104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0201"
FT                   /product="putative outer membrane protein"
FT                   /note="hypothetical 30.2 da protein in stfG 3'region
FT                   precursor. (SW:YADU_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19165"
FT                   /db_xref="InterPro:IPR021407"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87663"
FT                   /protein_id="AAL19165.1"
FT                   /translation="MKIIRTLFLLLIAVYGSSVVAKPMLKATFSSTTMYYGIGPNSDKS
FT                   IVAEVTIATPEGVYYGSWNLSGHRKGETLTADSWSGPEPAPKVVLKDFDNTVSRSACKN
FT                   LPSNWRGCGSFTLEITVQSDDYGCPWLASSHIVATTFITNETYSPPDTRSSVCPKVPVD
FT                   TFDISWDANVSKQKTTLMLDATGGTVNRTLHTYLMEGGKLCDGSKFDNRGAYCRFVSSG
FT                   ITLNVLGCDQSSVTTSAVDHPITDVELHDINVAVNTRNIGSGQFTSTCSFQYIIDEL"
     atgaaaataa tacggacttt atttttgctg ctgattgccg tttatggcag ttcggtagtg        60
     gccaaaccca tgctgaaagc gacgttttca agcaccacga tgtattatgg tattggccct       120
     aatagcgaca aatctattgt ggcggaggtg acgatagcga ctccggaggg agtgtactat       180
     ggctcctgga acctttcggg acatcgtaaa ggagaaacgc taaccgcaga ctcctggtct       240
     gggccagaac ctgcgccgaa ggttgtattg aaggattttg ataacactgt ttcgcgatct       300
     gcgtgcaaga atcttccctc gaactggagg gggtgtggtt cttttaccct ggagattacg       360
     gtacaaagcg atgattatgg ttgcccctgg ctggcgtcga gccatatcgt tgctaccact       420
     tttatcacta acgaaacgta ttccccgccg gatacgcgca gttcagtttg cccgaaagtt       480
     cccgttgata cttttgatat ctcctgggat gcgaacgttt cgaaacagaa aacaaccctc       540
     atgcttgatg ccaccggtgg cacggtgaat cgcacgttac atacctattt gatggagggg       600
     ggaaaactgt gcgatggcag caaatttgac aaccgtggcg cttattgccg ttttgtctca       660
     tcgggtatta cgctcaatgt gctgggctgc gaccagtcga gcgtcacgac cagcgccgtt       720
     gatcatccga taaccgatgt tgagcttcat gacattaatg tagcggtgaa cacccgcaac       780
     attggctccg ggcagttcac gtcgacctgt agcttccagt atattattga tgagctttag       840
//

If you have problems or comments...

PBIL Back to PBIL home page