(data stored in ACNUC7421 zone)

EMBL: AE006468.PE259

AE006468.PE259       Location/Qualifiers
FT   CDS_pept        complement(305732..306727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0267"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19223"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRM0"
FT                   /protein_id="AAL19223.1"
FT                   /translation="MTGALNQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFR
FT                   LGQTPTMTFAPREIAQVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPT
FT                   LVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAESPLS
FT                   DHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQS
FT                   SVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYCW
FT                   EIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH"
     atgaccggcg ctctcaacca ggcgcagaaa accccctggc gttacggatt cctgaacctg        60
     atgcggcgcg tggatgccca gctctgtgat actccggcag gcagtatctg gcagccacgg       120
     atggaaaaat tccgtctggg acagacgccg acgatgacct ttgcgccacg ggaaatcgcc       180
     caggtcagct ggcaggatgg acgcctgcac ctgagcctgt acagcctcgg actatggggg       240
     ccaaacggcc cgttgccgct gcactatacc gagctggcac tgaaccgctc agagagtcgt       300
     cacgatccga cgctggttca tttttccaat atttttcacc accgctggct gacgcagttc       360
     tggcaggcat ggcgcagcgc ccagtccgct ggtggcgggc tggacaaacc ggaacacgac       420
     cgttttgcgt tttatatcgc cagtctcagc gggcaggatc tacgggaaag cgccgaaagc       480
     ccgctgtcag atcatgttcg cctggcagcc tccgcccatc tggtacgcga atcgcgcaat       540
     cctgacgggc tggccgccac gctggcgcac tatttcagcg taccttttgc ggtgaaagaa       600
     ttcgccctgc actggataac ggtggcgaac gatgaaatca cccgtctggg cacgcccgcg       660
     cagtcttcgg tgctgggcaa cggggcgctt atcggccagg ccgtaccgga tatgcagtac       720
     aaattccggc taattatcgg cccgctcacg ctggaggatt acctgcgttt tctgcccggc       780
     ggcaacaatc tgcccgtgct gacagaactg gtgcgtacgt tcatcggttt tgaatattgc       840
     tgggaaattg agctgcagtt gaagcctcat gccgcaccgc ctgcggtgat cggcggcgcg       900
     cagcggcttg gctggacggc ctgggcaggt aaagccatgc atgaccgtcc ggtgaccggc       960
     atgatttttg aacctgaaca cggcttaacc cactga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page