(data stored in ACNUC7421 zone)

EMBL: AE006468.PE265

AE006468.PE265       Location/Qualifiers
FT   CDS_pept        313934..314476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0273"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19229"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IS8"
FT                   /protein_id="AAL19229.1"
FT                   /translation="MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLAD
FT                   LAGKPREELPPVTDRKFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENM
FT                   DDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLANAP
FT                   KSAATQQDVSADNESAE"
     atggctatca acaatagcgc gcagaaattc atcgcgcgca accgcgcgcc gcgcgtgcag        60
     attgaatatg acgtagagat ttacggttcc gagaaaaaaa tcgagctgcc gttcgtgatg       120
     gcggtgctgg ccgatctggc cgggaaaccg cgtgaagaac tgccgccggt gacggatcgc       180
     aaattcctcg atattgatat tgataacttc aatgagcgca tgaaagccat tgcgccgcgc       240
     gtggcgttcg ctgtgccgaa tacgctgacg ggtgaaggtc agttgatggt cgatatcacg       300
     ctggaaaata tggacgactt ttcgccggca cagattgccc gcaaggtgga cgccctgaac       360
     cagttactgg aagcccgcac tcaactggcg aacctccaga cctacatgga tggcaaggcg       420
     ggggcggaaa atctggtcaa taaactgttg caggacccga ctctgctgaa aacgctggcg       480
     aatgcgccga aatcggccgc tacccagcaa gatgtgtcag cggataatga atcagcggaa       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page