(data stored in ACNUC7421 zone)

EMBL: AE006468.PE268

AE006468.PE268       Location/Qualifiers
FT   CDS_pept        316308..316640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0275"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19232"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL6"
FT                   /protein_id="AAL19232.1"
FT                   /translation="MSLKSDVPAAWQLSPRYMSRLWLSSIGVTQGKPENLMDLKPETKK
FT                   VNGENWSVWETERGSDKETDRYWVSCIYGHEQIWLTQPIPASSTRCKTRNFEGSPEDQS
FT                   VSFICN"
     gtgagcctga agtctgatgt cccagcggcg tggcagcttt ctccccgata tatgtcgcgt        60
     ttatggttaa gtagtattgg ggtaacgcag ggtaaacctg aaaacctgat ggatctcaaa       120
     ccagagacta aaaaagtaaa cggtgaaaat tggtctgtat gggaaacaga acgtggtagc       180
     gataaagaaa ccgatcgcta ttgggtttcg tgtatttatg gtcatgaaca gatatggttg       240
     acgcaaccaa tacctgcttc ttctactcgc tgtaagactc gtaattttga gggatcgcca       300
     gaagaccagt ctgtatcttt tatctgtaat tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page