(data stored in ACNUC7421 zone)

EMBL: AE006468.PE271

AE006468.PE271       Location/Qualifiers
FT   CDS_pept        318154..318537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0278"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19235"
FT                   /db_xref="InterPro:IPR032032"
FT                   /db_xref="InterPro:IPR038314"
FT                   /db_xref="PDB:4HFF"
FT                   /db_xref="PDB:4J30"
FT                   /db_xref="PDB:4J32"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL5"
FT                   /protein_id="AAL19235.1"
FT                   /translation="MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWAL
FT                   SHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFN
FT                   TMKCIDFIHDRELNELIKRRVEK"
     gtggatactg ccgtgaaatg gttaatatta gttactttca gcataagtgg aatgctggta        60
     tggcagccat cctttgcaca agaagcattg accacacaat attcacagtc ggaactctta       120
     aaaaattggg cgctgagtca ttgtctggca ttagtataca aagatgatgt cgttaaaaac       180
     gatgccagag ctacggccag tgcttacctt gaatatggta aacaatctgt ggagatttac       240
     catgaaattg atgagattgc gaaaaaatat tcagggttga aatataacgg ttcgatatca       300
     tcagatttta ataccatgaa gtgcatagat tttatccatg acagggaatt aaatgaatta       360
     attaaaaggc gtgtcgagaa gtaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page