(data stored in ACNUC7421 zone)

EMBL: AE006468.PE280

AE006468.PE280       Location/Qualifiers
FT   CDS_pept        328516..328932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0287"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19244"
FT                   /db_xref="InterPro:IPR018696"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IR5"
FT                   /protein_id="AAL19244.1"
FT                   /translation="MKKYAVEVLFMSACAGMFLPVFAWGGTDVNIDNPLAECVDIHPVH
FT                   RQEMDNLTILKTTVTLKKSTGECGCFSTLINYTSLLAQDVEGYGRGSAYSLQEGNISLA
FT                   KMQGRYPFSFVLSVDNQSVRDQKLALMIRCTPPL"
     gtgaaaaagt acgctgtaga ggttctgttt atgtctgcct gtgcaggaat gttcctgccc        60
     gtatttgcct ggggcggaac agatgtaaac attgataacc cgctggcgga gtgtgtggat       120
     atccatcccg ttcatcgtca ggaaatggat aaccttacca ttctgaaaac aacggtcaca       180
     ctgaaaaaaa gcaccggtga atgtggctgt ttctcaacat taatcaacta taccagctta       240
     ctggcgcagg atgttgaggg ttacggacgc ggaagtgcat attcccttca ggaggggaat       300
     atctcactgg cgaagatgca gggacgttat cctttcagct ttgtattatc ggtggataac       360
     cagtctgtac gggatcagaa gctggcgcta atgatacgtt gtacaccacc gctgtaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page