(data stored in ACNUC7421 zone)

EMBL: AE006468.PE281

AE006468.PE281       Location/Qualifiers
FT   CDS_pept        328956..329477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0288"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19245"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IR4"
FT                   /protein_id="AAL19245.1"
FT                   /translation="MMAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPE
FT                   GNYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRGQAAGTCEIYWANWGYNRIRLESAD
FT                   EKTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENGEKTFTVNVKYVS
FT                   GQQTNGGTKQ"
     atgatggcag taagactgac ttttgacggg caaaagctga catggcctgg tatcgggata        60
     tttaaggcga ccacggggtt accggattta cagtggccag ataaacagtg tgtgccggat       120
     gcggcgatac cggaagggaa ttataaattg tttattcagt ttcaggggga ggcaccgata       180
     agaaatgctg cggattgtga tctgggacca tcatggggct ggagtaccat tccgcgaggc       240
     caggctgccg gaacatgtga gatatactgg gcgaactggg gatataatcg tatccggctg       300
     gaatcagcgg atgagaagac ccgaaaagcc tgtgggggca agcggggtgg tttttatatc       360
     catgattcca ccaaaggtta cagtcatggt tgtattgaag tggaaccggt gtttttccgt       420
     attctgaaac aggagacgga aaaagaaaat ggtgaaaaga catttacggt taatgttaag       480
     tatgtttctg gtcagcaaac gaatggtgga acaaaacaat aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page