(data stored in ACNUC7421 zone)

EMBL: AE006468.PE291

AE006468.PE291       Location/Qualifiers
FT   CDS_pept        341179..341460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0298"
FT                   /product="putative integrase core domain protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73370.1); Blastp hit to AAC73370.1 (384 aa), 28%
FT                   identity in aa 221 - 295"
FT                   /db_xref="EnsemblGenomes-Gn:STM0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19255"
FT                   /db_xref="GOA:Q8ZRK5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK5"
FT                   /protein_id="AAL19255.1"
FT                   /translation="MLRMDKGPEFISLALAEWAKKHAVKLAFIQPGKPKKNVFITRFNR
FT                   TYRTEILNSYLFRTLNEVWEITDKGLSEYNCERPHESRNNMIPKEYRQ"
     atgctgcgta tggataaggg accggaattt atctcgctgg cactggctga atgggcaaag        60
     aaacatgcag taaagctggc gtttatccag ccgggtaagc cgaagaaaaa cgttttcatc       120
     acgcgcttta accggacata ccgtacagaa atactcaatt cttatctgtt cagaacgctg       180
     aatgaggtgt gggaaattac ggataaaggg ttatcagaat ataactgcga acgtccacat       240
     gaatcgcgga acaatatgat accgaaggaa taccgccaat aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page