(data stored in ACNUC7421 zone)

EMBL: AE006468.PE315

AE006468.PE315       Location/Qualifiers
FT   CDS_pept        369159..369380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0324"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19279"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ4"
FT                   /protein_id="AAL19279.1"
FT                   /translation="MFRTETATGTVTTLPIVITLTIIKHCCPHYFPADKVLSVDTFHLQ
FT                   RMEEAFRTGIVVTTTSGAHTSPQIMAFQ"
     ttgttccgga ctgagaccgc cacaggcact gtgacgacgc taccgattgt aatcacactc        60
     actataatta aacactgctg tccgcattat ttcccggctg acaaagtcct ctccgtggat       120
     acattccacc ttcagcgtat ggaagaagct ttccgcacag gcattgtcgt aacaacaacc       180
     tctggcgctc atacttcccc gcagattatg gcgtttcagt aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page