(data stored in ACNUC7421 zone)

EMBL: AE006468.PE319

AE006468.PE319       Location/Qualifiers
FT   CDS_pept        372774..374195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0329"
FT                   /product="putative 3-isopropylmalate isomerase"
FT                   /note="similar to E. coli 3-isopropylmalate isomerase
FT                   dehydratase subunit (AAC73183.1); Blastp hit to AAC73183.1
FT                   (466 aa), 52% identity in aa 2 - 465; subunit with LeuD"
FT                   /db_xref="EnsemblGenomes-Gn:STM0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19283"
FT                   /db_xref="GOA:Q8ZRJ0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRJ0"
FT                   /protein_id="AAL19283.1"
FT                   /translation="MSAKTLYEKLVESHTIRELDNEGHVLLYIDRSILNEYTSPQAFSG
FT                   LRERGRTVRHPDTFLLNIDHVNPTRSQRDDLMTDPGGQLQVDYFRENAADFGITLFDVL
FT                   DPRQGIEHVVAHEQGLVMPGMVIAAGDSHTTTYGAFGALGFGIGTSEIEHLLATQTLVY
FT                   RKLKTMRVSVQGELPFACSAKDIVLELLERIGADGATGYAIEFVGEAISALSVEGRMTL
FT                   CNMAVEAGARGAIIAPDKKVFDYIYGKPQMPVGELWQQALLEWSQLSSDADAVFDKTVA
FT                   INCHDLEPKVTWGISPDQTGSITGRVPFPEQETNPLKRLALEKALHYMGLTAGMLLKDI
FT                   RISHAFIGSCTNGRIEDLRAVAKVLEGRKIASHVRGIIVPGSTMVRRQAEEEGLAKIFI
FT                   AAGFEWRQSGCSMCLAMNEDVLSPGDRCASGTNRNFPGRQGAGARTHLMSPAMVAAAAV
FT                   AGHLVDVRSLLQAGE"
     atgtctgcta aaacgctgta tgaaaaatta gttgagtcac ataccattcg tgaacttgat        60
     aacgaaggac atgttttact ttatattgat cgttcaatac tgaatgaata taccagcccg       120
     caggcattta gcgggttaag agaacgcggc cgcaccgttc ggcaccccga cacgttttta       180
     ttgaatattg accatgttaa tcctacgcgg tcgcaacggg atgacttaat gaccgatccg       240
     ggaggacagc tacaggttga ttactttcgg gaaaatgccg ctgactttgg catcacatta       300
     tttgatgtgc tggatccgcg tcaggggatt gaacacgtgg ttgctcatga acaagggcta       360
     gtgatgcctg gcatggtgat cgccgccggg gatagtcaca cgacaaccta cggtgcattt       420
     ggcgcgctgg gctttggtat cgggacgtcg gaaattgaac atctgctggc cacgcagacg       480
     ctggtttacc gcaagctcaa aaccatgcgc gtaagtgttc agggagagct acctttcgcc       540
     tgttccgcaa aagatattgt tcttgaattg cttgaacgta ttggcgctga tggcgcgacg       600
     ggatatgcca ttgaatttgt gggtgaggcc atcagcgcgt tgagcgttga aggacgaatg       660
     acgctctgca acatggcggt agaagcgggg gcgcgtggtg ccattattgc gccggataaa       720
     aaggtttttg actatatcta cggtaaaccg caaatgcctg taggtgaact ctggcagcag       780
     gcattgctgg aatggtcaca gttgagcagc gatgctgatg cggtatttga taagacggtg       840
     gcgatcaact gccatgatct tgagcctaaa gtcacctggg gaatcagtcc ggatcaaaca       900
     ggttccatca ccggacgtgt tcctttcccg gaacaggaaa ccaatccgct taagcgcctg       960
     gcgcttgaga aggcccttca ttacatggga ttaacggctg gcatgttgct gaaagatatt      1020
     cgtatctctc acgcttttat tggttcatgc acaaatggtc gcattgagga tttgcgtgcc      1080
     gttgcgaagg tgcttgaagg gcgcaaaatc gccagccatg ttcgcgggat cattgtgcct      1140
     ggttcaacaa tggtaagacg ccaggcggaa gaagaaggac tggcgaaaat ctttattgct      1200
     gccggttttg aatggcggca gtcgggttgc tcaatgtgcc ttgcgatgaa tgaagatgta      1260
     ttgtcgcccg gcgatcgctg tgcatcaggt acgaaccgta acttccctgg acgacagggc      1320
     gctggagcaa gaacgcattt gatgagcccg gcgatggttg cggcggcggc ggtagcgggg      1380
     catctggtcg atgttcggtc attacttcag gcaggggaat aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page