(data stored in ACNUC7421 zone)

EMBL: AE006468.PE320

AE006468.PE320       Location/Qualifiers
FT   CDS_pept        374197..374823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0330"
FT                   /product="putative 3-isopropylmalate isomerase
FT                   (dehydratase), subunit with LeuC"
FT                   /note="similar to E. coli isopropylmalate isomerase subunit
FT                   (AAC73182.1); Blastp hit to AAC73182.1 (201 aa), 39%
FT                   identity in aa 3 - 193"
FT                   /db_xref="EnsemblGenomes-Gn:STM0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19284"
FT                   /db_xref="GOA:Q8ZRI9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRI9"
FT                   /protein_id="AAL19284.1"
FT                   /translation="MDTFKQISGRIAPMLEPNIDTDVIMPKQFLKGIDRQGLDKGVFFD
FT                   RRFMAGGQPNPDFILNMPGWQSATFLLVGPNFGCGSSREHAVWGLKQLGVRGLIGSTFA
FT                   GIFDDNCQRNGILTVSLDEPALARLAQLAASADTNSITVSLDRCEITTAEETISFVISE
FT                   LKRAMLAAGEDAIAWTLQYLPEIENFEVAHYSRRPWLKRPASPRG"
     atggatacgt ttaagcaaat cagcgggcga attgcgccga tgctggaacc gaatatcgac        60
     actgatgtga ttatgccaaa acagttcctg aaagggatcg atcgccaggg gctggataaa       120
     ggggtgtttt tcgatcgtcg ctttatggct ggcggccaac caaatcctga ttttattctg       180
     aacatgccgg gctggcagag cgcgacattc ctgctggttg gccccaattt tggctgtgga       240
     tcgagtcgtg aacacgccgt atggggatta aaacaactgg gagtacgggg gctgataggt       300
     agcacatttg caggcatttt cgatgataac tgccaacgca acgggatcct cacggtctca       360
     ttagatgaac ctgctttggc gcgcctggcg cagcttgccg cgagtgctga taccaattct       420
     atcactgttt cactcgatcg ctgcgaaatt acgacggcag aggaaacgat ctcctttgtg       480
     atcagtgaac tcaaacgggc gatgctggcc gcaggcgaag atgcgatagc ctggacattg       540
     caatacttgc cggagattga aaattttgag gttgcgcatt attcacggcg gccgtggcta       600
     aaacgccctg catccccgcg cggttaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page