(data stored in ACNUC7421 zone)

EMBL: AE006468.PE332

AE006468.PE332       Location/Qualifiers
FT   CDS_pept        386311..386610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0342"
FT                   /product="putative periplasmic protein"
FT                   /note="unknown (gi|6707277)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19296"
FT                   /db_xref="GOA:Q8ZRH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH7"
FT                   /protein_id="AAL19296.1"
FT                   /translation="MYYSKRTLLIIFVIFIAIVAIGSIIALEWVNRDSYRTNNLICTTK
FT                   SEAYIAPRKLYMDGGLVLDLKSGRITLHYDVTTDTKEKRLFFVISASANCAERV"
     atgtattaca gtaaaagaac gttactgatt atatttgtaa tatttatcgc cattgtcgca        60
     atcggatcga taatagcgct tgagtgggta aatcgtgact cttatagaac caataatctt       120
     atatgcacga caaaatcaga agcgtatatt gcgccacgaa aattgtacat ggatggtgga       180
     cttgtgctgg atcttaaatc cggcaggatt accctacact acgatgttac taccgatacg       240
     aaagagaaac ggcttttttt cgtgatatct gcatcagcaa actgcgcaga acgggtatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page