(data stored in ACNUC7421 zone)

EMBL: AE006468.PE333

AE006468.PE333       Location/Qualifiers
FT   CDS_pept        387110..388684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0343"
FT                   /product="putative diguanylate cyclase/phosphodiesterase
FT                   domain 1"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC75237.1); Blastp hit to AAC75237.1 (518 aa), 31%
FT                   identity in aa 10 - 512"
FT                   /db_xref="EnsemblGenomes-Gn:STM0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19297"
FT                   /db_xref="GOA:Q8ZRH6"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH6"
FT                   /protein_id="AAL19297.1"
FT                   /translation="MKVRKLFLMLFIAVPLIVMILVGLLAGIFQLKRDIAVSANTLLRF
FT                   SADISAASWQVAGKAARLAESSCTDTLKELSRTRAFTPYVRDIGFLENGDITCSFVTGT
FT                   ERYHFSRLAGLSLPASYPERWLRSIGSMAEGPDRLVVVYVKKVAADKAAFVIVDSQYVQ
FT                   ELMEILAAERASAFSLTFGAGEAITSAAKLRGKAFLTQRFTSTDHTIQLMVRTPFSTLS
FT                   AYWLQNLFIFIPLSLCLSVGMMLFYRRWYLKRLSLAREIARGITHNEFTVHYQPVFNVK
FT                   HGSCGGVEALMRWPQPDGRFITPDIFITAAENEGMIIPLSRHLFELIAHDVINWTVPDD
FT                   FYISVNISPAHLMDDGFIQDIEALRTRLGTITLMLELTERSLIVEPSQVAEKLSTLREK
FT                   GVLIAIDDFGTGYCSLSYLQQLPVDSLKIDRTFIDTIDTSSDDVPVLDTIITLSQRLGL
FT                   NVVAEGVSTQHQLRYILSHGVGFVQGFLYARPMGTNDFMSWLGKSAQRQNGLLKGESGS
FT                   ASDLVAE"
     ttgaaagtaa gaaagctatt tctgatgttg tttattgccg ttccactgat cgtaatgata        60
     ttggtggggt tactcgcggg tatcttccag ctaaaacgag atatcgccgt cagcgccaat       120
     acgctgctgc ggtttagcgc ggatatatcc gccgcctcct ggcaagtcgc cggaaaagcc       180
     gccagactgg ctgagagttc ctgcactgac acgctgaaag aactgtccag aacgcgggcc       240
     ttcactcctt atgtccgtga cattggattt ctggaaaatg gtgatatcac ttgctccttt       300
     gtcacaggaa ccgaacgcta tcatttttcc cggctggcag ggctttcttt acctgcttct       360
     tatccggaac ggtggttgcg atctatcggt agtatggccg aaggacccga tcgccttgtt       420
     gtggtgtatg tgaaaaaagt agcagcggat aaagcggctt tcgtcattgt ggattcgcag       480
     tatgtccagg agctcatgga gatattggct gcagaaagag catcagcctt tagcctgaca       540
     ttcggcgcag gagaggcgat taccagcgct gcgaagttgc gcggtaaggc gtttttaacg       600
     cagcggttca cctcaaccga tcacactatc cagctgatgg tgcgaacccc tttctcaacg       660
     ttatcggcat actggttaca aaaccttttt atttttattc cgctgtcatt gtgtctttct       720
     gtagggatga tgttgttcta caggcgctgg tatttaaaac gcttatctct ggcccgggag       780
     attgccaggg gaataacgca caatgaattt acggtacatt atcaacctgt ttttaatgtt       840
     aaacacggta gttgcggcgg cgtggaggcg ctaatgcgct ggccgcaacc ggatggccgt       900
     tttataactc ccgatatttt tattaccgcc gcagaaaatg aaggcatgat tattccactc       960
     tctcgtcatc tgttcgaact gattgctcat gacgtgataa actggactgt accggatgat      1020
     ttctatatca gcgtaaatat atcgcctgcg catcttatgg atgacggttt tatacaagat      1080
     atagaggcgc tcaggactcg tttgggaacg ataacgctta tgttggagct caccgaacgt      1140
     agcctgattg tagaaccttc acaggtcgca gaaaaacttt caacgctccg tgaaaaaggc      1200
     gtgttaatag cgattgatga ttttgggacc ggctattgct ccctctccta tctccagcaa      1260
     ttacctgtag actctcttaa aatagacaga acgtttatcg ataccattga taccagcagc      1320
     gatgatgttc ctgtcctgga tactatcatt acgctgagtc agcgactggg actcaatgtg      1380
     gttgccgaag gggtcagtac ccagcaccaa ttgcgttaca tcttaagcca cggggtagga      1440
     ttcgttcagg gatttcttta tgccaggccg atggggacta atgactttat gagttggctt      1500
     ggcaagtcag cccagcggca aaatggtttg ctcaaggggg aaagcggatc cgcgagcgat      1560
     ctggtggctg aataa                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page