(data stored in ACNUC7421 zone)

EMBL: AE006468.PE340

AE006468.PE340       Location/Qualifiers
FT   CDS_pept        complement(392420..393931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0350"
FT                   /product="homology to outer membrane efflux protein"
FT                   /note="similar to E. coli putative resistance protein
FT                   (AAC73673.1); Blastp hit to AAC73673.1 (457 aa), 37%
FT                   identity in aa 7 - 457"
FT                   /db_xref="EnsemblGenomes-Gn:STM0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19304"
FT                   /db_xref="GOA:Q8ZRH0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH0"
FT                   /protein_id="AAL19304.1"
FT                   /translation="MRTALIRMISKHNDGNGIMKITFTGYRQTATLATLAFVTTLAGCT
FT                   MAPKHERPASPTAMVYPYATSTVSGAPDAADIGWRDFFHDPLLQELIAIALRNNRDLRK
FT                   AGLNVEAARALYRIQRAEMLPTLGIATAMDASRTPADLSVMDESEINRRYEAAGATTAW
FT                   ELDLWGRVRSLSDQALAAYMALDETYIAARMSLVSEVASAWLTLRADRELLRLTEDTLA
FT                   AQKSSYTLTTQLARTGNATQLDLRMAEIALRSAEINRAAYTRQLARDRNALELLLGQPL
FT                   TPELSRRLNEAVTLTEGAIPTTLPGGLPSDLLVRRPDIRAAEYRLRGANARIGAARAAF
FT                   FPTISLTGSAGTASASLSGLFEPGSGSWRFLPQITLPLFHGGALRADLDRAHVQKQIEI
FT                   ARYENVIQQAFRDVADGLAGQRTLNDQVQSEQRAVEASQIAYELAGLRFQEGVDDYLTL
FT                   LDTHRMLYGAQQRLVRTRLMQQLNIINLYKALGGGWREYSEKKQG"
     gtgagaaccg cgttgattcg catgatcagc aagcataatg atgggaatgg cataatgaag        60
     atcactttta caggctatcg gcagaccgcc acgctggcga cgcttgcttt cgtcaccacg       120
     cttgctggct gtacgatggc gccgaagcac gaacgccccg catcgccgac tgcgatggtc       180
     tatccctacg caacgtcaac cgtttctggc gcgccggatg ccgctgacat tggctggcgt       240
     gatttcttcc acgatccgct tctacaggaa ctgattgcga tcgcgttacg caataatcgg       300
     gatttacgca aggcagggct caatgttgaa gccgcccggg cgttataccg cattcagcgc       360
     gcggagatgc tgccgacgct cggcatcgcc accgccatgg acgccagtcg cactcccgcc       420
     gatctcagcg tcatggacga gtctgagatt aaccgacgct acgaggcggc tggggcgacg       480
     acggcctggg aactggatct ctgggggcga gtgcgaagcc ttagcgacca ggcattagcc       540
     gcctatatgg cgcttgatga gacgtacatt gcggcgcgaa tgagcctggt ttccgaagtc       600
     gccagcgcct ggctgacgct acgggctgac cgggagctgc tgcgcttaac cgaggatacg       660
     ctggccgcgc aaaaaagttc atacacattg acgacccagc ttgcccggac aggtaacgcc       720
     acacagctcg atctgcgtat ggcggagatc gcgctgcgtt ctgccgaaat caatcgcgcg       780
     gcgtatacgc gacagttggc gcgggatcgt aacgcgctgg aattgctgtt gggccagccg       840
     ctcacgcctg aactgtcgcg tcgactaaac gaagcggtca cgcttacaga aggcgcgatc       900
     ccgaccacac tgccaggcgg attaccgtca gatctgctgg tacgccgccc ggatattcgc       960
     gccgccgagt acaggctgcg cggcgcaaac gcccggatag gcgcagcgcg cgccgccttc      1020
     ttcccgacca tcagcctgac aggctcggcg ggaacggcca gcgcgtctct tagcggactc      1080
     tttgaaccgg gatcgggaag ctggcgtttt ctaccgcaaa tcaccttgcc tctctttcac      1140
     ggcggcgcat tacgcgctga cctggatagg gcgcatgtcc aaaaacagat tgaaatcgcc      1200
     aggtatgaaa acgttattca gcaagccttt cgcgacgtgg cggatggtct ggcgggacag      1260
     cgtacgctga atgaccaggt gcaatcagaa caacgcgcgg ttgaagccag tcaaatcgcc      1320
     tatgagctgg ccggactccg ttttcaggaa ggcgtcgatg actaccttac gctgcttgat      1380
     acccatcgta tgctttatgg cgcacaacag cgcctggtac gcacacgtct catgcaacag      1440
     ttaaatatca ttaacctgta taaagcatta ggcggcggtt ggcgggaata cagtgagaaa      1500
     aagcaaggtt ag                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page